Human Nppc/CNP/CNP2 ORF/cDNA clone-Lentivirus plasmid (NM_024409)

Cat. No.: pGMLP004949
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human Nppc/CNP/CNP2 Lentiviral expression plasmid for Nppc lentivirus packaging, Nppc lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to NPPC/Nppc/CNP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004949
Gene Name Nppc
Accession Number NM_024409
Gene ID 4880
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 381 bp
Gene Alias CNP,CNP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCATCTCTCCCAGCTGCTGGCCTGCGCCCTGCTGCTCACGCTGCTCTCCCTCCGGCCCTCCGAAGCCAAGCCCGGGGCGCCGCCGAAGGTCCCGCGAACCCCGCCGGCAGAGGAGCTGGCCGAGCCGCAGGCTGCGGGCGGCGGTCAGAAGAAGGGCGACAAGGCTCCCGGGGGCGGGGGCGCCAATCTCAAGGGCGACCGGTCGCGACTGCTCCGGGACCTGCGCGTGGACACCAAGTCGCGGGCAGCGTGGGCTCGCCTTCTGCAAGAGCACCCCAACGCGCGCAAATACAAAGGAGCCAACAAGAAGGGCTTGTCCAAGGGCTGCTTCGGCCTCAAGCTGGACCGAATCGGCTCCATGAGCGGCCTGGGATGTTAG
ORF Protein Sequence MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T87689-Ab Anti-ANFC/ NPPC/ CNP functional antibody
    Target Antigen GM-Tg-g-T87689-Ag NPPC protein
    ORF Viral Vector pGMLP004949 Human Nppc Lentivirus plasmid
    ORF Viral Vector vGMLP004949 Human Nppc Lentivirus particle


    Target information

    Target ID GM-T87689
    Target Name NPPC
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4880
    Gene ID 100057178 (Equus caballus), 101097827 (Felis catus), 114593 (Rattus norvegicus), 18159 (Mus musculus)
    281356 (Bos taurus), 4880 (Homo sapiens), 610169 (Canis lupus familiaris), 717026 (Macaca mulatta)
    Gene Symbols & Synonyms NPPC,Nppc,CNP,lbab,CNP2
    Target Alternative Names C-type natriuretic peptide,CNP,CNP2,NPPC,Nppc,lbab
    Uniprot Accession P23582,P55206,P55207,Q61839
    Additional SwissProt Accessions: P55207,Q61839,P55206,P23582
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG cGMP-PKG signaling pathway, Vascular smooth muscle contraction, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000000840, ENSMUSG00000026241, ENSBTAG00000003253, ENSG00000163273, ENSCAFG00845024603, ENSMMUG00000006981
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.