Human TMEM37/PR/PR1 ORF/cDNA clone-Lentivirus plasmid (NM_183240)

Cat. No.: pGMLP004894
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM37/PR/PR1 Lentiviral expression plasmid for TMEM37 lentivirus packaging, TMEM37 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TMEM37/PR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $443.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004894
Gene Name TMEM37
Accession Number NM_183240
Gene ID 140738
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 573 bp
Gene Alias PR,PR1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTGCCGTCGGCGTGCAGGCCCAGAGGCCTTTGGGCCAAAGGCAGCCCCGCCGGTCCTTCTTTGAATCCTTCATCCGGACCCTCATCATCACGTGTGTGGCCCTGGCTGTGGTCCTGTCCTCGGTCTCCATTTGTGATGGGCACTGGCTCCTGGCTGAGGACCGCCTCTTCGGGCTCTGGCACTTCTGCACCACCACCAACCAGACGATCTGCTTCAGAGACCTGGGCCAGGCCCATGTGCCCGGGCTGGCCGTGGGCATGGGCCTGGTACGCAGCGTGGGCGCCTTGGCCGTGGTGGCCGCCATTTTTGGCCTGGAGTTCCTCATGGTGTCCCAGTTGTGCGAGGACAAACACTCACAGTGCAAGTGGGTCATGGGTTCCATCCTCCTCCTGGTGTCTTTCGTCCTCTCCTCCGGCGGGCTCCTGGGTTTTGTGATCCTCCTCAGGAACCAAGTCACACTCATCGGCTTCACCCTAATGTTTTGGTGCGAATTCACTGCCTCCTTCCTCCTCTTCCTGAACGCCATCAGCGGCCTTCACATCAACAGCATCACCCATCCCTGGGAATGA
ORF Protein Sequence MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQTICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSGGLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2095-Ab Anti-TMEM37 monoclonal antibody
    Target Antigen GM-Tg-g-IP2095-Ag TMEM37 protein
    ORF Viral Vector pGMLP004894 Human TMEM37 Lentivirus plasmid
    ORF Viral Vector vGMLP004894 Human TMEM37 Lentivirus particle


    Target information

    Target ID GM-IP2095
    Target Name TMEM37
    Gene Group Identifier
    （Target Gene ID in Homo species)         		140738
    Gene ID 101085394 (Felis catus), 102148293 (Equus caballus), 140738 (Homo sapiens), 170706 (Mus musculus)
    245953 (Rattus norvegicus), 610386 (Canis lupus familiaris), 613815 (Bos taurus), 695060 (Macaca mulatta)
    Gene Symbols & Synonyms TMEM37,Tmem37,PR,PR1,Pr,Pr1
    Target Alternative Names Neuronal voltage-gated calcium channel gamma-like subunit,PR,PR1,Pr,Pr1,TMEM37,Tmem37,Transmembrane protein 37,Voltage-dependent calcium channel gamma-like subunit
    Uniprot Accession Q8VHW1,Q8WXS4,Q9JJV3
    Additional SwissProt Accessions: Q8WXS4,Q9JJV3,Q8VHW1
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000031200, ENSG00000171227, ENSMUSG00000050777, ENSBTAG00000026825, ENSMMUG00000060725
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.