Human MYL4/ALC1/AMLC ORF/cDNA clone-Lentivirus plasmid (NM_002476)
Cat. No.: pGMLP004880
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MYL4/ALC1/AMLC Lentiviral expression plasmid for MYL4 lentivirus packaging, MYL4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MYL4/ALC1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004880 |
Gene Name | MYL4 |
Accession Number | NM_002476 |
Gene ID | 4635 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 594 bp |
Gene Alias | ALC1,AMLC,GT1,PRO1957 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTCCCAAGAAGCCTGAGCCTAAGAAGGAGGCAGCCAAGCCAGCTCCAGCTCCAGCTCCAGCCCCTGCACCAGCCCCTGCCCCAGCTCCTGAGGCTCCCAAGGAACCTGCCTTTGACCCCAAGAGTGTAAAGATAGACTTCACTGCCGACCAGATTGAAGAGTTCAAAGAGGCCTTTTCATTGTTTGACCGGACCCCGACTGGAGAGATGAAGATCACCTACGGCCAGTGCGGGGATGTACTGCGGGCCCTGGGCCAGAACCCTACCAATGCCGAGGTGCTGCGTGTGCTGGGCAAGCCCAAGCCTGAAGAGATGAATGTCAAGATGCTGGACTTTGAGACGTTCTTGCCCATCCTGCAGCACATTTCCCGCAACAAGGAGCAGGGCACCTATGAGGACTTCGTGGAGGGCCTGCGTGTCTTTGACAAGGAGAGCAATGGCACGGTCATGGGTGCTGAGCTTCGGCACGTCCTTGCCACCCTGGGAGAGAAGATGACTGAGGCTGAAGTGGAGCAGCTGTTAGCTGGGCAAGAGGATGCCAATGGCTGCATCAATTATGAAGCCTTTGTCAAGCACATCATGTCAGGGTGA |
ORF Protein Sequence | MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2615-Ab | Anti-MYL4 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2615-Ag | MYL4 protein |
ORF Viral Vector | pGMLP004880 | Human MYL4 Lentivirus plasmid |
ORF Viral Vector | vGMLP004880 | Human MYL4 Lentivirus particle |
Target information
Target ID | GM-IP2615 |
Target Name | MYL4 |
Gene Group Identifier (Target Gene ID in Homo species) |
4635 |
Gene ID |
100054510 (Equus caballus), 100316866 (Felis catus), 17896 (Mus musculus), 4635 (Homo sapiens) 480490 (Canis lupus familiaris), 504201 (Bos taurus), 688228 (Rattus norvegicus), 717354 (Macaca mulatta) |
Gene Symbols & Synonyms | MYL4,Myl4,ELC,GT1,ALC1,AMLC,Myla,ELC1a,MLC1a,MLC1EMB,PRO1957,MLC1E/A |
Target Alternative Names | ALC1,AMLC,ELC,ELC1a,GT1,MLC1E/A,MLC1EMB,MLC1a,MYL4,Myl4,Myla,Myosin light chain 1,Myosin light chain 4,Myosin light chain alkali GT-1 isoform,PRO1957,embryonic muscle/atrial isoform |
Uniprot Accession |
P09541,P12829,P17209
Additional SwissProt Accessions: P09541,P12829,P17209 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | |
Disease | |
Disease from KEGG | Adrenergic signaling in cardiomyocytes |
Gene Ensembl | ENSECAG00000020967, ENSMUSG00000061086, ENSG00000198336, ENSBTAG00000021916, ENSMMUG00000018600 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.