Human SBSPON/C8orf84/RPESP ORF/cDNA clone-Lentivirus plasmid (NM_153225)

Cat. No.: pGMLP004793
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SBSPON/C8orf84/RPESP Lentiviral expression plasmid for SBSPON lentivirus packaging, SBSPON lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SBSPON/C8orf84 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $498.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004793
Gene Name SBSPON
Accession Number NM_153225
Gene ID 157869
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 795 bp
Gene Alias C8orf84,RPESP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGACCCTGTGGATGGCGCTGTGCGCGCTGTCGCGGCTGTGGCCCGGGGCCCAGGCCGGCTGCGCCGAGGCCGGGCGCTGCTGTCCCGGCCGGGACCCCGCCTGCTTCGCCCGCGGCTGGAGGCTGGACAGGGTCTACGGGACGTGTTTCTGCGACCAAGCCTGTCGCTTCACCGGGGACTGCTGCTTCGACTACGACAGGGCGTGCCCAGCTCGCCCGTGCTTCGTGGGGGAATGGAGCCCCTGGAGTGGTTGTGCAGACCAGTGCAAGCCTACAACCCGTGTGCGGAGGCGCTCGGTGCAGCAGGAGCCTCAGAACGGCGGGGCGCCCTGCCCACCCCTGGAAGAGAGAGCTGGCTGCCTGGAGTACTCCACCCCGCAGGGCCAGGACTGCGGGCACACCTATGTTCCTGCCTTTATAACTACCTCTGCATTCAACAAGGAGAGAACACGACAAGCTACGTCTCCACACTGGTCTACACACACAGAGGATGCTGGATACTGTATGGAGTTTAAGACAGAGTCCTTGACTCCTCACTGTGCTCTGGAAAACTGGCCCTTGACTAGATGGATGCAGTATCTCCGAGAGGGATACACGGTGTGTGTGGATTGTCAGCCTCCAGCTATGAACTCTGTGAGCCTTCGTTGTTCTGGAGATGGCCTGGACTCCGATGGAAATCAGACTCTCCATTGGCAAGCAATTGGTAATCCTCGGTGTCAAGGAACTTGGAAAAAAGTTCGGCGAGTAGACCAGTGTTCTTGTCCAGCTGTTCACAGTTTTATTTTTATATAG
ORF Protein Sequence MRTLWMALCALSRLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAGCLEYSTPQGQDCGHTYVPAFITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPHCALENWPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1261-Ab Anti-SBSPO/ SBSPON/ C8orf84 functional antibody
    Target Antigen GM-Tg-g-SE1261-Ag SBSPON protein
    ORF Viral Vector pGMLP004793 Human SBSPON Lentivirus plasmid
    ORF Viral Vector vGMLP004793 Human SBSPON Lentivirus particle


    Target information

    Target ID GM-SE1261
    Target Name SBSPON
    Gene Group Identifier
    (Target Gene ID in Homo species)
    157869
    Gene ID 100061205 (Equus caballus), 101099429 (Felis catus), 157869 (Homo sapiens), 226866 (Mus musculus)
    297757 (Rattus norvegicus), 525332 (Bos taurus), 610426 (Canis lupus familiaris), 697412 (Macaca mulatta)
    Gene Symbols & Synonyms SBSPON,Sbspon,RPESP,C8orf84,Gm106,Rpesp,RGD1559717,C14H8orf84,C29H8orf84
    Target Alternative Names C14H8orf84,C29H8orf84,C8orf84,Gm106,RGD1559717,RPE-spondin,RPESP,Rpesp,SBSPON,Sbspon,Somatomedin-B and thrombospondin type-1 domain-containing protein
    Uniprot Accession Q32L50,Q3UPR9,Q8IVN8
    Additional SwissProt Accessions: Q8IVN8,Q3UPR9,Q32L50
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000011744, ENSG00000164764, ENSMUSG00000032719, ENSBTAG00000017249, ENSCAFG00845027981, ENSMMUG00000023210
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.