Human IL19/IL-10C/MDA1 ORF/cDNA clone-Lentivirus plasmid (NM_153758)

Cat. No.: pGMLP004788
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL19/IL-10C/MDA1 Lentiviral expression plasmid for IL19 lentivirus packaging, IL19 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-19/IL19/IL19/IL-10C products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $462
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004788
Gene Name IL19
Accession Number NM_153758
Gene ID 29949
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 648 bp
Gene Alias IL-10C,MDA1,NG.1,ZMDA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGTTACAGTGTGTTTCCCTTTGGCTCCTGGGTACAATACTGATATTGTGCTCAGTAGACAACCACGGTCTCAGGAGATGTCTGATTTCCACAGACATGCACCATATAGAAGAGAGTTTCCAAGAAATCAAAAGAGCCATCCAAGCTAAGGACACCTTCCCAAATGTCACTATCCTGTCCACATTGGAGACTCTGCAGATCATTAAGCCCTTAGATGTGTGCTGCGTGACCAAGAACCTCCTGGCGTTCTACGTGGACAGGGTGTTCAAGGATCATCAGGAGCCAAACCCCAAAATCTTGAGAAAAATCAGCAGCATTGCCAACTCTTTCCTCTACATGCAGAAAACTCTGCGGCAATGTCAGGAACAGAGGCAGTGTCACTGCAGGCAGGAAGCCACCAATGCCACCAGAGTCATCCATGACAACTATGATCAGCTGGAGGTCCACGCTGCTGCCATTAAATCCCTGGGAGAGCTCGACGTCTTTCTAGCCTGGATTAATAAGAATCATGAAGTAATGTTCTCAGCTTGA
ORF Protein Sequence MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T44584-Ab Anti-IL19/ IL-10C/ MDA1 functional antibody
    Target Antigen GM-Tg-g-T44584-Ag IL19 protein
    Cytokine cks-Tg-g-GM-T44584 IL19 (IL19) protein & antibody
    ORF Viral Vector pGMLP004788 Human IL19 Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-026 Human IL19 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-109 Human IL19 Adenovirus plasmid
    ORF Viral Vector vGMLP004788 Human IL19 Lentivirus particle
    ORF Viral Vector vGMLP-IL-026 Human IL19 Lentivirus particle
    ORF Viral Vector vGMAP-IL-109 Human IL19 Adenovirus particle


    Target information

    Target ID GM-T44584
    Target Name IL-19/IL19
    Gene Group Identifier
    （Target Gene ID in Homo species)         		29949
    Gene ID 100055588 (Equus caballus), 101090582 (Felis catus), 29949 (Homo sapiens), 329244 (Mus musculus)
    490265 (Canis lupus familiaris), 527634 (Bos taurus), 681145 (Rattus norvegicus), 694806 (Macaca mulatta)
    Gene Symbols & Synonyms IL19,Il19,MDA1,NG.1,ZMDA1,IL-10C
    Target Alternative Names IL-10C,IL-19,IL19,Il19,Interleukin-19,MDA1,Melanoma differentiation-associated protein-like protein,NG.1,ZMDA1
    Uniprot Accession Q8CJ70,Q9UHD0
    Additional SwissProt Accessions: Q9UHD0,Q8CJ70
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, JAK-STAT signaling pathway
    Gene Ensembl ENSG00000142224, ENSMUSG00000016524, ENSCAFG00845001334, ENSBTAG00000006692, ENSMMUG00000023570
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.