Human HRH4/AXOR35/BG26 ORF/cDNA clone-Lentivirus plasmid (NM_001160166)

Cat. No.: pGMLP004787
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HRH4/AXOR35/BG26 Lentiviral expression plasmid for HRH4 lentivirus packaging, HRH4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HRH4/H4R/HRH4/AXOR35 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004787
Gene Name HRH4
Accession Number NM_001160166
Gene ID 59340
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 204 bp
Gene Alias AXOR35,BG26,GPCR105,GPRv53,H4,H4R,HH4R
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCAGATACTAATAGCACAATCAATTTATCACTAAGCACTCGTGTTACTTTAGCATTTTTTATGTCCTTAGTAGCTTTTGCTATAATGCTAGGAAATGCTTTGGTCATTTTAGCTTTTGTGGTGGACAAAAACCTTAGACATCGAAGTAGTTATTTTTTTCTTAACTTGGCCATCTCTGACTTCTTTGTGGGTGTCTTATAG
ORF Protein Sequence MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAISDFFVGVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T26500-Ab Anti-HRH4/ H4R/ AXOR35 monoclonal antibody
    Target Antigen GM-Tg-g-T26500-Ag H4R/HRH4 VLP (virus-like particle)
    ORF Viral Vector pGMLP004787 Human HRH4 Lentivirus plasmid
    ORF Viral Vector vGMLP004787 Human HRH4 Lentivirus particle


    Target information

    Target ID GM-T26500
    Target Name HRH4/H4R
    Gene Group Identifier
    （Target Gene ID in Homo species)         		59340
    Gene ID 100034111 (Equus caballus), 101100602 (Felis catus), 170704 (Rattus norvegicus), 225192 (Mus musculus)
    490512 (Canis lupus familiaris), 59340 (Homo sapiens), 702044 (Macaca mulatta), 783354 (Bos taurus)
    Gene Symbols & Synonyms HRH4,Hrh4,H4,H4R,BG26,HH4R,AXOR35,GPRv53,GPCR105
    Target Alternative Names AXOR35,BG26,G-protein coupled receptor 105,GPCR105,GPRv53,H4,H4R,HH4R,HRH4,Histamine H4 receptor,Hrh4,Pfi-013,SP9144
    Uniprot Accession Q91ZY1,Q91ZY2,Q9H3N8
    Additional SwissProt Accessions: Q91ZY1,Q91ZY2,Q9H3N8
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction
    Gene Ensembl ENSECAG00000006494, ENSMUSG00000037346, ENSCAFG00845013170, ENSG00000134489, ENSMMUG00000015065, ENSBTAG00000020467
    Target Classification GPCR


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.