Human CCL17/A-152E5.3/ABCD-2 ORF/cDNA clone-Lentivirus plasmid (NM_002987)

Cat. No.: pGMLP004761
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL17/A-152E5.3/ABCD-2 Lentiviral expression plasmid for CCL17 lentivirus packaging, CCL17 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCL17/A-152E5.3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004761
Gene Name CCL17
Accession Number NM_002987
Gene ID 6361
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 285 bp
Gene Alias A-152E5.3,ABCD-2,SCYA17,TARC
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCCACTGAAGATGCTGGCCCTGGTCACCCTCCTCCTGGGGGCTTCTCTGCAGCACATCCACGCAGCTCGAGGGACCAATGTGGGCCGGGAGTGCTGCCTGGAGTACTTCAAGGGAGCCATTCCCCTTAGAAAGCTGAAGACGTGGTACCAGACATCTGAGGACTGCTCCAGGGATGCCATCGTTTTTGTAACTGTGCAGGGCAGGGCCATCTGTTCGGACCCCAACAACAAGAGAGTGAAGAATGCAGTTAAATACCTGCAAAGCCTTGAGAGGTCTTGA
ORF Protein Sequence MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0742-Ab Anti-CCL17/ A-152E5.3/ ABCD-2 functional antibody
    Target Antigen GM-Tg-g-SE0742-Ag CCL17 protein
    Cytokine cks-Tg-g-GM-SE0742 chemokine (C-C motif) ligand 17 (CCL17) protein & antibody
    ORF Viral Vector pGMLP004761 Human CCL17 Lentivirus plasmid
    ORF Viral Vector vGMLP004761 Human CCL17 Lentivirus particle


    Target information

    Target ID GM-SE0742
    Target Name CCL17
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6361
    Gene ID 100140488 (Bos taurus), 100630824 (Equus caballus), 117518 (Rattus norvegicus), 20295 (Mus musculus)
    403586 (Canis lupus familiaris), 493832 (Felis catus), 574180 (Macaca mulatta), 6361 (Homo sapiens)
    Gene Symbols & Synonyms CCL17,Ccl17,Tarc,Scya17,Abcd-2,Scya17l,TARC,ABCD-2,SCYA17,A-152E5.3
    Target Alternative Names CCL17,C-C motif chemokine 17,CC chemokine TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine,TARC,ABCD-2,SCYA17,A-152E5.3
    Uniprot Accession Q8HYP9,Q8I021,Q92583,Q95N01,Q9ERE0,Q9WUZ6
    Additional SwissProt Accessions: Q9ERE0,Q9WUZ6,Q95N01,Q8I021,Q8HYP9,Q92583
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease cancer, Breast Cancer, Overactive bladder
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, C-type lectin receptor signaling pathway, IL-17 signaling pathway
    Gene Ensembl ENSBTAG00000066638, ENSMUSG00000031780, ENSCAFG00845003329, ENSMMUG00000058419, ENSG00000102970
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.