Human BST1/CD157 ORF/cDNA clone-Lentivirus plasmid (NM_004334)

Cat. No.: pGMLP004759
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BST1/CD157 Lentiviral expression plasmid for BST1 lentivirus packaging, BST1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD157/BST1/BST1/CD157 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $539.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004759
Gene Name BST1
Accession Number NM_004334
Gene ID 683
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 957 bp
Gene Alias CD157
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCCCAGGGGTGCGCGGCATCGCGGCTGCTCCAGCTGCTGCTGCAGCTTCTGCTTCTACTGTTGCTGCTGGCGGCGGGCGGGGCGCGCGCGCGGTGGCGCGGGGAGGGCACCAGCGCACACTTGCGGGACATCTTCCTGGGCCGCTGCGCCGAGTACCGCGCACTGCTGAGTCCCGAGCAGCGGAACAAGAACTGCACAGCCATCTGGGAAGCCTTTAAAGTGGCGCTGGACAAGGATCCCTGCTCCGTGCTGCCCTCAGACTATGACCTTTTTATTAACTTGTCCAGGCACTCTATTCCCAGAGATAAGTCCCTGTTCTGGGAAAATAGCCACCTCCTTGTTAACAGCTTTGCAGACAACACCCGTCGTTTTATGCCCCTGAGCGATGTTCTGTATGGCAGGGTTGCAGATTTCTTGAGCTGGTGTCGACAGAAAAATGACTCTGGACTCGATTACCAATCCTGCCCTACATCAGAAGACTGTGAAAATAATCCTGTGGATTCCTTTTGGAAAAGGGCATCCATCCAGTATTCCAAGGATAGTTCTGGGGTGATCCACGTCATGCTGAATGGTTCAGAGCCAACAGGAGCCTATCCCATCAAAGGTTTTTTTGCAGATTATGAAATTCCAAACCTCCAGAAGGAAAAAATTACACGAATCGAGATCTGGGTTATGCATGAAATTGGGGGACCCAATGTGGAATCCTGCGGGGAAGGCAGCATGAAAGTCCTGGAAAAGAGGCTGAAGGACATGGGGTTCCAGTACAGCTGTATTAATGATTACCGACCAGTGAAGCTCTTACAGTGCGTGGACCACAGCACCCATCCTGACTGTGCCTTAAAGTCGGCAGCAGCCGCTACTCAAAGAAAAGCCCCAAGTCTTTATACAGAACAAAGGGCGGGTCTTATCATTCCCCTCTTTCTGGTGCTGGCTTCCAGGACTCAACTGTAA
ORF Protein Sequence MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0141-Ab Anti-BST1/ CD157 monoclonal antibody
    Target Antigen GM-Tg-g-MP0141-Ag BST1 VLP (virus-like particle)
    ORF Viral Vector pGMLP004759 Human BST1 Lentivirus plasmid
    ORF Viral Vector vGMLP004759 Human BST1 Lentivirus particle


    Target information

    Target ID GM-MP0141
    Target Name CD157/BST1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		683
    Gene ID 100068968 (Equus caballus), 101101052 (Felis catus), 12182 (Mus musculus), 616757 (Bos taurus)
    683 (Homo sapiens), 722848 (Macaca mulatta), 81506 (Rattus norvegicus)
    Gene Symbols & Synonyms BST1,Bst1,Bp3,BP-3,Ly65,Bsta1,CD157,114/A10,A530073F09,cADPR2
    Target Alternative Names 114/A10,A530073F09,ADP-ribosyl cyclase 2,ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2,BP-3,BST1,Bone marrow stromal cell antigen 1 (BST-1),Bp3,Bst1,Bsta1,CD157,Cyclic ADP-ribose hydrolase 2 (cADPR hydrolase 2),Ly65,cADPR2
    Uniprot Accession Q10588,Q63072,Q64277
    Additional SwissProt Accessions: Q64277,Q10588,Q63072
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Metabolic pathways, Salivary secretion, Pancreatic secretion
    Gene Ensembl ENSECAG00000023398, ENSMUSG00000029082, ENSBTAG00000006156, ENSG00000109743, ENSMMUG00000015294
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.