Human Artn/ART/ENOVIN ORF/cDNA clone-Lentivirus plasmid (NM_001136215)
Cat. No.: pGMLP004758
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human Artn/ART/ENOVIN Lentiviral expression plasmid for Artn lentivirus packaging, Artn lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
ARTN/Artn/ART products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004758 |
Gene Name | Artn |
Accession Number | NM_001136215 |
Gene ID | 9048 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 687 bp |
Gene Alias | ART,ENOVIN,EVN,NBN |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAACTTGGACTTGGAGGCCTCTCCACGCTGTCCCACTGCCCCTGGCCTAGGCAGCAGGCTCCACTTGGTCTCTCCGCGCAGCCTGCCCTGTGGCCCACCCTGGCCGCTCTGGCTCTGCTGAGCAGCGTCGCAGAGGCCTCCCTGGGCTCCGCGCCCCGCAGCCCTGCCCCCCGCGAAGGCCCCCCGCCTGTCCTGGCGTCCCCCGCCGGCCACCTGCCGGGGGGACGCACGGCCCGCTGGTGCAGTGGAAGAGCCCGGCGGCCGCCGCCGCAGCCTTCTCGGCCCGCGCCCCCGCCGCCTGCACCCCCATCTGCTCTTCCCCGCGGGGGCCGCGCGGCGCGGGCTGGGGGCCCGGGCAGCCGCGCTCGGGCAGCGGGGGCGCGGGGCTGCCGCCTGCGCTCGCAGCTGGTGCCGGTGCGCGCGCTCGGCCTGGGCCACCGCTCCGACGAGCTGGTGCGTTTCCGCTTCTGCAGCGGCTCCTGCCGCCGCGCGCGCTCTCCACACGACCTCAGCCTGGCCAGCCTACTGGGCGCCGGGGCCCTGCGACCGCCCCCGGGCTCCCGGCCCGTCAGCCAGCCCTGCTGCCGACCCACGCGCTACGAAGCGGTCTCCTTCATGGACGTCAACAGCACCTGGAGAACCGTGGACCGCCTCTCCGCCACCGCCTGCGGCTGCCTGGGCTGA |
ORF Protein Sequence | MELGLGGLSTLSHCPWPRQQAPLGLSAQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0680-Ab | Anti-ARTN/ ART/ ENOVIN functional antibody |
Target Antigen | GM-Tg-g-SE0680-Ag | ARTN protein |
Cytokine | cks-Tg-g-GM-SE0680 | artemin (ARTN) protein & antibody |
ORF Viral Vector | pGMLP004758 | Human Artn Lentivirus plasmid |
ORF Viral Vector | vGMLP004758 | Human Artn Lentivirus particle |
Target information
Target ID | GM-SE0680 |
Target Name | ARTN |
Gene Group Identifier (Target Gene ID in Homo species) |
9048 |
Gene ID |
106782773 (Equus caballus), 111561723 (Felis catus), 11876 (Mus musculus), 119868041 (Canis lupus familiaris) 362572 (Rattus norvegicus), 530812 (Bos taurus), 701641 (Macaca mulatta), 9048 (Homo sapiens) |
Gene Symbols & Synonyms | ARTN,Artn,neublastin,ART,EVN,NBN,ENOVIN |
Target Alternative Names | ART,ARTN,Artemin,Artn,ENOVIN,EVN,Enovin,NBN,Neublastin,neublastin |
Uniprot Accession |
Q5T4W7,Q6AYE8,Q9Z0L2
Additional SwissProt Accessions: Q9Z0L2,Q6AYE8,Q5T4W7 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Cytokine Target |
Disease | |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000028258, ENSMUSG00000028539, ENSBTAG00000040060, ENSMMUG00000061167, ENSG00000117407 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.