Human Artn/ART/ENOVIN ORF/cDNA clone-Lentivirus plasmid (NM_001136215)

Cat. No.: pGMLP004758
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human Artn/ART/ENOVIN Lentiviral expression plasmid for Artn lentivirus packaging, Artn lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ARTN/Artn/ART products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $471.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004758
Gene Name Artn
Accession Number NM_001136215
Gene ID 9048
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 687 bp
Gene Alias ART,ENOVIN,EVN,NBN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAACTTGGACTTGGAGGCCTCTCCACGCTGTCCCACTGCCCCTGGCCTAGGCAGCAGGCTCCACTTGGTCTCTCCGCGCAGCCTGCCCTGTGGCCCACCCTGGCCGCTCTGGCTCTGCTGAGCAGCGTCGCAGAGGCCTCCCTGGGCTCCGCGCCCCGCAGCCCTGCCCCCCGCGAAGGCCCCCCGCCTGTCCTGGCGTCCCCCGCCGGCCACCTGCCGGGGGGACGCACGGCCCGCTGGTGCAGTGGAAGAGCCCGGCGGCCGCCGCCGCAGCCTTCTCGGCCCGCGCCCCCGCCGCCTGCACCCCCATCTGCTCTTCCCCGCGGGGGCCGCGCGGCGCGGGCTGGGGGCCCGGGCAGCCGCGCTCGGGCAGCGGGGGCGCGGGGCTGCCGCCTGCGCTCGCAGCTGGTGCCGGTGCGCGCGCTCGGCCTGGGCCACCGCTCCGACGAGCTGGTGCGTTTCCGCTTCTGCAGCGGCTCCTGCCGCCGCGCGCGCTCTCCACACGACCTCAGCCTGGCCAGCCTACTGGGCGCCGGGGCCCTGCGACCGCCCCCGGGCTCCCGGCCCGTCAGCCAGCCCTGCTGCCGACCCACGCGCTACGAAGCGGTCTCCTTCATGGACGTCAACAGCACCTGGAGAACCGTGGACCGCCTCTCCGCCACCGCCTGCGGCTGCCTGGGCTGA
ORF Protein Sequence MELGLGGLSTLSHCPWPRQQAPLGLSAQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0680-Ab Anti-ARTN/ ART/ ENOVIN functional antibody
    Target Antigen GM-Tg-g-SE0680-Ag ARTN protein
    Cytokine cks-Tg-g-GM-SE0680 artemin (ARTN) protein & antibody
    ORF Viral Vector pGMLP004758 Human Artn Lentivirus plasmid
    ORF Viral Vector vGMLP004758 Human Artn Lentivirus particle


    Target information

    Target ID GM-SE0680
    Target Name ARTN
    Gene Group Identifier
    (Target Gene ID in Homo species)
    9048
    Gene ID 106782773 (Equus caballus), 111561723 (Felis catus), 11876 (Mus musculus), 119868041 (Canis lupus familiaris)
    362572 (Rattus norvegicus), 530812 (Bos taurus), 701641 (Macaca mulatta), 9048 (Homo sapiens)
    Gene Symbols & Synonyms ARTN,Artn,neublastin,ART,EVN,NBN,ENOVIN
    Target Alternative Names ART,ARTN,Artemin,Artn,ENOVIN,EVN,Enovin,NBN,Neublastin,neublastin
    Uniprot Accession Q5T4W7,Q6AYE8,Q9Z0L2
    Additional SwissProt Accessions: Q9Z0L2,Q6AYE8,Q5T4W7
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000028258, ENSMUSG00000028539, ENSBTAG00000040060, ENSMMUG00000061167, ENSG00000117407
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.