Human GH1/GH/GH-N ORF/cDNA clone-Lentivirus plasmid (NM_022559)
Cat. No.: pGMLP004749
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human GH1/GH/GH-N Lentiviral expression plasmid for GH1 lentivirus packaging, GH1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
GH1/HGH/GH1/GH products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP004749 |
| Gene Name | GH1 |
| Accession Number | NM_022559 |
| Gene ID | 2688 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 609 bp |
| Gene Alias | GH,GH-N,GHB5,GHN,hGH-N,IGHD1B |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTACAGGCTCCCGGACGTCCCTGCTCCTGGCTTTTGGCCTGCTCTGCCTGCCCTGGCTTCAAGAGGGCAGTGCCTTCCCAACCATTCCCTTATCCAGGCTTTTTGACAACGCTATGCTCCGCGCCCATCGTCTGCACCAGCTGGCCTTTGACACCTACCAGGAGTTTAACCCCCAGACCTCCCTCTGTTTCTCAGAGTCTATTCCGACACCCTCCAACAGGGAGGAAACACAACAGAAATCCAACCTAGAGCTGCTCCGCATCTCCCTGCTGCTCATCCAGTCGTGGCTGGAGCCCGTGCAGTTCCTCAGGAGTGTCTTCGCCAACAGCCTGGTGTACGGCGCCTCTGACAGCAACGTCTATGACCTCCTAAAGGACCTAGAGGAAGGCATCCAAACGCTGATGGGGAGGCTGGAAGATGGCAGCCCCCGGACTGGGCAGATCTTCAAGCAGACCTACAGCAAGTTCGACACAAACTCACACAACGATGACGCACTACTCAAGAACTACGGGCTGCTCTACTGCTTCAGGAAGGACATGGACAAGGTCGAGACATTCCTGCGCATCGTGCAGTGCCGCTCTGTGGAGGGCAGCTGTGGCTTCTAG |
| ORF Protein Sequence | MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T19784-Ab | Anti-SOMA/ GH1/ GH functional antibody |
| Target Antigen | GM-Tg-g-T19784-Ag | GH1 protein |
| ORF Viral Vector | pGMLP004749 | Human GH1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000702 | Human GH1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004749 | Human GH1 Lentivirus particle |
| ORF Viral Vector | vGMLV000702 | Human GH1 Lentivirus particle |
Target information
| Target ID | GM-T19784 |
| Target Name | GH1/HGH |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2688 |
| Gene ID |
14599 (Mus musculus), 24391 (Rattus norvegicus), 2688 (Homo sapiens), 493931 (Felis catus) 718156 (Macaca mulatta) |
| Gene Symbols & Synonyms | Gh,Gh1,GH1,Ghb1,RNGHGP,GH,GHN,GH-N,GHB5,IGHD2,hGH-N,IGHD1A,IGHD1B,GHB3 |
| Target Alternative Names | GH,GH-N,GH-N),GH1,GHB3,GHB5,GHN,Gh,Gh1,Ghb1,Growth hormone (GH,Growth hormone 1,HGH,IGHD1A,IGHD1B,IGHD2,Pituitary growth hormone,RNGHGP,Somatotropin,hGH-N |
| Uniprot Accession |
P01241,P01244,P06880,P33093,P46404
Additional SwissProt Accessions: P06880,P01244,P01241,P46404,P33093 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Ovary Cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Neuroactive ligand-receptor interaction, PI3K-Akt signaling pathway, JAK-STAT signaling pathway, Growth hormone synthesis, secretion and action |
| Gene Ensembl | ENSMUSG00000020713, ENSG00000259384, ENSMMUG00000039847 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


