Human IV/IV/SIAT3-C ORF/cDNA clone-Lentivirus plasmid (NM_175039)

Cat. No.: pGMLP004730
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IV/IV/SIAT3-C Lentiviral expression plasmid for IV lentivirus packaging, IV lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ST6GALNAC4/IV products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $527.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004730
Gene Name IV
Accession Number NM_175039
Gene ID 27090
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 909 bp
Gene Alias IV,SIAT3-C,SIAT3C,SIAT7-D,SIAT7D,ST6GalNAc,ST6GALNACIV
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGCTCCGGGTCGGCTCGTGCTCATCATCCTGTGCTCCGTGGTCTTCTCTGCCGTCTACATCCTCCTGTGCTGCTGGGCCGGCCTGCCCCTCTGCCTGGCCACCTGCCTGGACCACCACTTCCCCACAGGCTCCAGGCCCACTGTGCCGGGACCCCTGCACTTCAGTGGATATAGCAGTGTGCCAGATGGGAAGCCGCTGGTCCGCGAGCCCTGCCGCAGCTGTGCCGTGGTGTCCAGCTCCGGCCAAATGCTGGGCTCAGGCCTGGGTGCTGAGATCGACAGTGCCGAGTGCGTGTTCCGCATGAACCAGGCGCCCACCGTGGGCTTTGAGGCGGATGTGGGCCAGCGCAGCACCCTGCGTGTCGTCTCACACACAAGCGTGCCGCTGCTGCTGCGCAACTATTCACACTACTTCCAGAAGGCCCGAGACACGCTCTACATGGTGTGGGGCCAGGGCAGGCACATGGACCGGGTGCTCGGCGGCCGCACCTACCGCACGCTGCTGCAGCTCACCAGGATGTACCCCGGCCTGCAGGTGTACACCTTCACGGAGCGCATGATGGCCTACTGCGACCAGATCTTCCAGGACGAGACGGGCAAGAACCGGAGGCAGTCGGGCTCCTTCCTCAGCACCGGCTGGTTCACCATGATCCTCGCGCTGGAGCTGTGTGAGGAGATCGTGGTCTATGGGATGGTCAGCGACAGCTACTGCAGGGAGAAGAGCCACCCCTCAGTGCCTTACCACTACTTTGAGAAGGGCCGGCTAGATGAGTGTCAGATGTACCTGGCACACGAGCAGGCGCCCCGAAGCGCCCACCGCTTCATCACTGAGAAGGCGGTCTTCTCCCGCTGGGCCAAGAAGAGGCCCATCGTGTTCGCCCATCCGTCCTGGAGGACTGAGTAG
ORF Protein Sequence MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYSSVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRTE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1832-Ab Anti-ST6GALNAC4 monoclonal antibody
    Target Antigen GM-Tg-g-IP1832-Ag ST6GALNAC4 protein
    ORF Viral Vector pGMLP004730 Human IV Lentivirus plasmid
    ORF Viral Vector vGMLP004730 Human IV Lentivirus particle


    Target information

    Target ID GM-IP1832
    Target Name ST6GALNAC4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		27090
    Gene ID 100067121 (Equus caballus), 101094459 (Felis catus), 20448 (Mus musculus), 27090 (Homo sapiens)
    404124 (Bos taurus), 407764 (Rattus norvegicus), 609133 (Canis lupus familiaris), 705879 (Macaca mulatta)
    Gene Symbols & Synonyms ST6GALNAC4,St6galnac4,Siat7d,SIAT7-D,ST6GalNAcIV,IV,SIAT3C,SIAT7D,SIAT3-C,ST6GalNAc,ST6GALNACIV,SIAT7B,ST6GALNAC2,st6GalNAc-IV,siat7D
    Target Alternative Names ST6GALNAC4,Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase,NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase, ST6GalNAc IV (ST6GalNAcIV), Sialyltransferase 3C (SIAT3-C), Sialyltransferase 7D (SIAT7-D),IV,SIAT3C,SIAT7D,SIAT3-C,SIAT7-D,ST6GalNAc,ST6GALNACIV
    Uniprot Accession Q9H4F1,Q9R2B6
    Additional SwissProt Accessions: Q9R2B6,Q9H4F1
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG Metabolic pathways, Mucin type O-glycan biosynthesis, Glycosphingolipid biosynthesis - ganglio series
    Gene Ensembl ENSECAG00000017908, ENSMUSG00000079442, ENSG00000136840, ENSBTAG00000046548, ENSCAFG00845005201, ENSMMUG00000015917
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.