Human FGF22 ORF/cDNA clone-Lentivirus plasmid (NM_020637)

Cat. No.: pGMLP004721
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FGF22/ Lentiviral expression plasmid for FGF22 lentivirus packaging, FGF22 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FGF22 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $428.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004721
Gene Name FGF22
Accession Number NM_020637
Gene ID 27006
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 513 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGCCGCCGCCTGTGGCTGGGCCTGGCCTGGCTGCTGCTGGCGCGGGCGCCGGACGCCGCGGGAACCCCGAGCGCGTCGCGGGGACCGCGCAGCTACCCGCACCTGGAGGGCGACGTGCGCTGGCGGCGCCTCTTCTCCTCCACTCACTTCTTCCTGCGCGTGGATCCCGGCGGCCGCGTGCAGGGCACCCGCTGGCGCCACGGCCAGGACAGCATCCTGGAGATCCGCTCTGTACACGTGGGCGTCGTGGTCATCAAAGCAGTGTCCTCAGGCTTCTACGTGGCCATGAACCGCCGGGGCCGCCTCTACGGGTCGCGACTCTACACCGTGGACTGCAGGTTCCGGGAGCGCATCGAAGAGAACGGCCACAACACCTACGCCTCACAGCGCTGGCGCCGCCGCGGCCAGCCCATGTTCCTGGCGCTGGACAGGAGGGGGGGGCCCCGGCCAGGCGGCCGGACGCGGCGGTACCACCTGTCCGCCCACTTCCTGCCCGTCCTGGTCTCCTGA
ORF Protein Sequence MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0920-Ab Anti-FGF22 functional antibody
    Target Antigen GM-Tg-g-SE0920-Ag FGF22 protein
    Cytokine cks-Tg-g-GM-SE0920 fibroblast growth factor 22 (FGF22) protein & antibody
    ORF Viral Vector pGMLP004721 Human FGF22 Lentivirus plasmid
    ORF Viral Vector vGMLP004721 Human FGF22 Lentivirus particle


    Target information

    Target ID GM-SE0920
    Target Name FGF22
    Gene Group Identifier
    （Target Gene ID in Homo species)         		27006
    Gene ID 100072461 (Equus caballus), 101083745 (Felis catus), 170579 (Rattus norvegicus), 27006 (Homo sapiens)
    519657 (Bos taurus), 612404 (Canis lupus familiaris), 67112 (Mus musculus), 702727 (Macaca mulatta)
    Gene Symbols & Synonyms FGF22,Fgf22,Fgf5d,FGF5D,FGF-22,2210414E06Rik
    Target Alternative Names FGF22,Fibroblast growth factor 22,FGF-22
    Uniprot Accession Q9ESS2,Q9HCT0
    Additional SwissProt Accessions: Q9HCT0,Q9ESS2
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSECAG00000039463, ENSG00000070388, ENSBTAG00000027357, ENSCAFG00845014846, ENSMUSG00000020327, ENSMMUG00000055423
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.