Human SCGB1D1/LIPA/LPHA ORF/cDNA clone-Lentivirus plasmid (NM_006552)

Cat. No.: pGMLP004668
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SCGB1D1/LIPA/LPHA Lentiviral expression plasmid for SCGB1D1 lentivirus packaging, SCGB1D1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SCGB1D1/LIPA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004668
Gene Name SCGB1D1
Accession Number NM_006552
Gene ID 10648
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 273 bp
Gene Alias LIPA,LPHA,LPNA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCTGTCGGTGTGTCTCCTGCTGCTCACGCTGGCCCTTTGCTGCTACCGGGCAAATGCAGTGGTCTGCCAAGCTCTTGGTTCTGAAATCACAGGCTTCTTATTAGCTGGAAAACCTGTGTTCAAGTTCCAACTTGCCAAATTTAAGGCACCTCTGGAAGCTGTTGCAGCCAAGATGGAAGTGAAGAAATGCGTGGATACGATGGCCTATGAGAAAAGAGTGCTAATTACAAAAACATTGGGAAAAATAGCAGAGAAATGTGATCGCTGA
ORF Protein Sequence MRLSVCLLLLTLALCCYRANAVVCQALGSEITGFLLAGKPVFKFQLAKFKAPLEAVAAKMEVKKCVDTMAYEKRVLITKTLGKIAEKCDR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1265-Ab Anti-SG1D1/ SCGB1D1/ LIPA functional antibody
    Target Antigen GM-Tg-g-SE1265-Ag SCGB1D1 protein
    ORF Viral Vector pGMLP004668 Human SCGB1D1 Lentivirus plasmid
    ORF Viral Vector vGMLP004668 Human SCGB1D1 Lentivirus particle


    Target information

    Target ID GM-SE1265
    Target Name SCGB1D1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    10648
    Gene ID 10648 (Homo sapiens)
    Gene Symbols & Synonyms SCGB1D1,LIPA,LPHA,LPNA
    Target Alternative Names LIPA,LPHA,LPNA,Lipophilin-A,SCGB1D1,Secretoglobin family 1D member 1
    Uniprot Accession O95968
    Additional SwissProt Accessions: O95968
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000168515
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.