Human CD99/HBA71/MIC2 ORF/cDNA clone-Lentivirus plasmid (NM_002414)

Cat. No.: pGMLP004612
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD99/HBA71/MIC2 Lentiviral expression plasmid for CD99 lentivirus packaging, CD99 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CD99/MIC2/CD99/HBA71 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $439.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004612
Gene Name CD99
Accession Number NM_002414
Gene ID 4267
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 558 bp
Gene Alias HBA71,MIC2,MIC2X,MIC2Y,MSK5X
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCGCGGGGCTGCGCTGGCGCTGCTGCTCTTCGGCCTGCTGGGTGTTCTGGTCGCCGCCCCGGATGGTGGTTTCGATTTATCCGATGCCCTTCCTGACAATGAAAACAAGAAACCCACTGCAATCCCCAAGAAACCCAGTGCTGGGGATGACTTTGACTTAGGAGATGCTGTTGTTGATGGAGAAAATGACGACCCACGACCACCGAACCCACCCAAACCGATGCCAAATCCAAACCCCAACCACCCTAGTTCCTCCGGTAGCTTTTCAGATGCTGACCTTGCGGATGGCGTTTCAGGTGGAGAAGGAAAAGGAGGCAGTGATGGTGGAGGCAGCCACAGGAAAGAAGGGGAAGAGGCCGACGCCCCAGGCGTGATCCCCGGGATTGTGGGGGCTGTCGTGGTCGCCGTGGCTGGAGCCATCTCTAGCTTCATTGCTTACCAGAAAAAGAAGCTATGCTTCAAAGAAAATGCAGAACAAGGGGAGGTGGACATGGAGAGCCACCGGAATGCCAACGCAGAGCCAGCTGTTCAGCGTACTCTTTTAGAGAAATAG
ORF Protein Sequence MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IO103-Ab Anti-CD99/ MIC2/ HBA71 monoclonal antibody
    Target Antigen GM-Tg-g-IO103-Ag MIC2/CD99 VLP (virus-like particle)
    ORF Viral Vector pGMLP004612 Human CD99 Lentivirus plasmid
    ORF Viral Vector pGMPC000443 Human CD99 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004612 Human CD99 Lentivirus particle


    Target information

    Target ID GM-IO103
    Target Name CD99/MIC2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4267
    Gene ID 100064394 (Equus caballus), 102902569 (Felis catus), 4267 (Homo sapiens), 509230 (Bos taurus)
    609832 (Canis lupus familiaris), 652929 (Rattus norvegicus), 673094 (Mus musculus), 720563 (Macaca mulatta)
    Gene Symbols & Synonyms CD99,Cd99,MIC2,HBA71,MIC2X,MIC2Y,MSK5X,D4,Pilr-l,pilr-1,1110061M03Rik,2410026K10Rik
    Target Alternative Names CD99, MIC2,CD99 antigen,12E7, E2 antigen, Protein MIC2, T-cell surface glycoprotein E2,MIC2,HBA71,MIC2X,MIC2Y,MSK5X
    Uniprot Accession P14209,Q8VCN6
    Additional SwissProt Accessions: P14209,Q8VCN6
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000039059, ENSG00000002586,ENSG00000292348, ENSBTAG00000008114, ENSCAFG00845022471, ENSMMUG00000018687
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.