Human CD99/HBA71/MIC2 ORF/cDNA clone-Lentivirus plasmid (NM_002414)
Cat. No.: pGMLP004612
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CD99/HBA71/MIC2 Lentiviral expression plasmid for CD99 lentivirus packaging, CD99 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CD99/MIC2/CD99/HBA71 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP004612 |
| Gene Name | CD99 |
| Accession Number | NM_002414 |
| Gene ID | 4267 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 558 bp |
| Gene Alias | HBA71,MIC2,MIC2X,MIC2Y,MSK5X |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCCGCGGGGCTGCGCTGGCGCTGCTGCTCTTCGGCCTGCTGGGTGTTCTGGTCGCCGCCCCGGATGGTGGTTTCGATTTATCCGATGCCCTTCCTGACAATGAAAACAAGAAACCCACTGCAATCCCCAAGAAACCCAGTGCTGGGGATGACTTTGACTTAGGAGATGCTGTTGTTGATGGAGAAAATGACGACCCACGACCACCGAACCCACCCAAACCGATGCCAAATCCAAACCCCAACCACCCTAGTTCCTCCGGTAGCTTTTCAGATGCTGACCTTGCGGATGGCGTTTCAGGTGGAGAAGGAAAAGGAGGCAGTGATGGTGGAGGCAGCCACAGGAAAGAAGGGGAAGAGGCCGACGCCCCAGGCGTGATCCCCGGGATTGTGGGGGCTGTCGTGGTCGCCGTGGCTGGAGCCATCTCTAGCTTCATTGCTTACCAGAAAAAGAAGCTATGCTTCAAAGAAAATGCAGAACAAGGGGAGGTGGACATGGAGAGCCACCGGAATGCCAACGCAGAGCCAGCTGTTCAGCGTACTCTTTTAGAGAAATAG |
| ORF Protein Sequence | MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IO103-Ab | Anti-CD99/ MIC2/ HBA71 monoclonal antibody |
| Target Antigen | GM-Tg-g-IO103-Ag | MIC2/CD99 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP004612 | Human CD99 Lentivirus plasmid |
| ORF Viral Vector | pGMPC000443 | Human CD99 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP004612 | Human CD99 Lentivirus particle |
Target information
| Target ID | GM-IO103 |
| Target Name | CD99/MIC2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4267 |
| Gene ID |
100064394 (Equus caballus), 102902569 (Felis catus), 4267 (Homo sapiens), 509230 (Bos taurus) 609832 (Canis lupus familiaris), 652929 (Rattus norvegicus), 673094 (Mus musculus), 720563 (Macaca mulatta) |
| Gene Symbols & Synonyms | CD99,Cd99,MIC2,HBA71,MIC2X,MIC2Y,MSK5X,D4,Pilr-l,pilr-1,1110061M03Rik,2410026K10Rik |
| Target Alternative Names | 1110061M03Rik,12E7,2410026K10Rik,CD99,CD99 antigen,Cd99,D4,E2 antigen,HBA71,MIC2,MIC2X,MIC2Y,MSK5X,Pilr-l,Protein MIC2,T-cell surface glycoprotein E2,pilr-1 |
| Uniprot Accession |
P14209,Q8VCN6
Additional SwissProt Accessions: P14209,Q8VCN6 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | cancer |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000039059, ENSG00000002586,ENSG00000292348, ENSBTAG00000008114, ENSCAFG00845022471, ENSMMUG00000018687 |
| Target Classification | Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


