Human GYPE/GPE/MiIX ORF/cDNA clone-Lentivirus plasmid (NM_002102)

Cat. No.: pGMLP004611
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GYPE/GPE/MiIX Lentiviral expression plasmid for GYPE lentivirus packaging, GYPE lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GYPE/GPE products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004611
Gene Name GYPE
Accession Number NM_002102
Gene ID 2996
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 237 bp
Gene Alias GPE,MiIX,MNS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTATGGAAAAATAATCTTTGTATTACTATTGTCAGGAATTGTGAGCATATCAGCATCAAGTACCACTGGTGTGGCAATGCACACTTCAACCTCTTCTTCAGTCACAAAGAGTTACATCTCATCACAGACAAATGGGATAACACTCATTAATTGGTGGGCGATGGCTCGTGTTATTTTTGAGGTGATGCTTGTTGTTGTTGGAATGATCATCTTAATTTCTTACTGTATTCGATGA
ORF Protein Sequence MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIFEVMLVVVGMIILISYCIR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0568-Ab Anti-GLPE/ GYPE/ GPE monoclonal antibody
    Target Antigen GM-Tg-g-MP0568-Ag GYPE VLP (virus-like particle)
    ORF Viral Vector pGMLP004611 Human GYPE Lentivirus plasmid
    ORF Viral Vector vGMLP004611 Human GYPE Lentivirus particle


    Target information

    Target ID GM-MP0568
    Target Name GYPE
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2996
    Gene ID 2996 (Homo sapiens)
    Gene Symbols & Synonyms GYPE,GPE,MNS,GYPA,MiIX
    Target Alternative Names GPE,GYPA,GYPE,Glycophorin-E,MNS,MiIX
    Uniprot Accession P15421
    Additional SwissProt Accessions: P15421
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000197465
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.