Human IL10RB/CDW210B/CRF2-4 ORF/cDNA clone-Lentivirus plasmid (NM_000628)

Cat. No.: pGMLP004604
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL10RB/CDW210B/CRF2-4 Lentiviral expression plasmid for IL10RB lentivirus packaging, IL10RB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-10RB/IL10RB/CDw210b/IL10RB/CDW210B products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $544.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004604
Gene Name IL10RB
Accession Number NM_000628
Gene ID 3588
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 978 bp
Gene Alias CDW210B,CRF2-4,CRFB4,D21S58,D21S66,IL-10R2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTGGAGCCTTGGGAGCTGGCTGGGTGGCTGCCTGCTGGTGTCAGCATTGGGAATGGTACCACCTCCCGAAAATGTCAGAATGAATTCTGTTAATTTCAAGAACATTCTACAGTGGGAGTCACCTGCTTTTGCCAAAGGGAACCTGACTTTCACAGCTCAGTACCTAAGTTATAGGATATTCCAAGATAAATGCATGAATACTACCTTGACGGAATGTGATTTCTCAAGTCTTTCCAAGTATGGTGACCACACCTTGAGAGTCAGGGCTGAATTTGCAGATGAGCATTCAGACTGGGTAAACATCACCTTCTGTCCTGTGGATGACACCATTATTGGACCCCCTGGAATGCAAGTAGAAGTACTTGCTGATTCTTTACATATGCGTTTCTTAGCCCCTAAAATTGAGAATGAATACGAAACTTGGACTATGAAGAATGTGTATAACTCATGGACTTATAATGTGCAATACTGGAAAAACGGTACTGATGAAAAGTTTCAAATTACTCCCCAGTATGACTTTGAGGTCCTCAGAAACCTGGAGCCATGGACAACTTATTGTGTTCAAGTTCGAGGGTTTCTTCCTGATCGGAACAAAGCTGGGGAATGGAGTGAGCCTGTCTGTGAGCAAACAACCCATGACGAAACGGTCCCCTCCTGGATGGTGGCCGTCATCCTCATGGCCTCGGTCTTCATGGTCTGCCTGGCACTCCTCGGCTGCTTCGCCTTGCTGTGGTGCGTTTACAAGAAGACAAAGTACGCCTTCTCCCCTAGGAATTCTCTTCCACAGCACCTGAAAGAGTTTTTGGGCCATCCTCATCATAACACACTTCTGTTTTTCTCCTTTCCATTGTCGGATGAGAATGATGTTTTTGACAAGCTAAGTGTCATTGCAGAAGACTCTGAGAGCGGCAAGCAGAATCCTGGTGACAGCTGCAGCCTCGGGACCCCGCCTGGGCAGGGGCCCCAAAGCTAG
ORF Protein Sequence MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-819 Pre-Made Eflepedocokin Alfa Biosimilar, Fusion Protein targeting IL10RB fused with human IGHG2 Fc (Fragment constant) via a peptidyl linker: Recombinant therapeutic protein targeting CDW210B/CRF2-4/CRFB4/D21S58/D21S66/IL-10R2
    Target Antibody GM-Tg-g-T14557-Ab Anti-I10R2/ IL10RB/ CDW210B monoclonal antibody
    Target Antigen GM-Tg-g-T14557-Ag IL10RB VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T14557 interleukin 10 receptor, beta (IL10RB) protein & antibody
    ORF Viral Vector pGMLP004604 Human IL10RB Lentivirus plasmid
    ORF Viral Vector vGMLP004604 Human IL10RB Lentivirus particle


    Target information

    Target ID GM-T14557
    Target Name IL-10RB/IL10RB/CDw210b
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3588
    Gene ID 100052549 (Equus caballus), 101090038 (Felis catus), 16155 (Mus musculus), 304091 (Rattus norvegicus)
    3588 (Homo sapiens), 478404 (Canis lupus familiaris), 706012 (Macaca mulatta), 767864 (Bos taurus)
    Gene Symbols & Synonyms IL10RB,Il10rb,Crfb4,CRF2-4,Il10r2,D21S58h,IL-10R2,D16H21S58,6620401D04Rik,RGD1560373,CRFB4,IBD25,D21S58,D21S66,CDW210B,IL-10RB
    Target Alternative Names IL-10RB, IL10RB, CDw210b,Interleukin-10 receptor subunit beta,IL-10 receptor subunit beta, IL-10R subunit beta, IL-10RB,Cytokine receptor class-II member 4, Cytokine receptor family 2 member 4 (CRF2-4), Interleukin-10 receptor subunit 2 (IL-10R subunit 2, IL-10R2),CRFB4,IBD25,CRF2-4,D21S58,D21S66,CDW210B,IL-10R2,IL-10RB
    Uniprot Accession Q08334,Q61190
    Additional SwissProt Accessions: Q61190,Q08334
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, JAK-STAT signaling pathway, Toxoplasmosis, Tuberculosis, Human cytomegalovirus infection
    Gene Ensembl ENSECAG00000007359, ENSMUSG00000022969, ENSG00000243646, ENSCAFG00845026648, ENSMMUG00000003956, ENSBTAG00000019404
    Target Classification Cytokine Receptor


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.