Human SRD5A2 ORF/cDNA clone-Lentivirus plasmid (NM_000348)

Cat. No.: pGMLP004602
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SRD5A2/ Lentiviral expression plasmid for SRD5A2 lentivirus packaging, SRD5A2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SRD5A2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $491.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004602
Gene Name SRD5A2
Accession Number NM_000348
Gene ID 6716
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 765 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGTTCAGTGCCAGCAGAGCCCAGTGCTGGCAGGCAGCGCCACTTTGGTCGCCCTTGGGGCACTGGCCTTGTACGTCGCGAAGCCCTCCGGCTACGGGAAGCACACGGAGAGCCTGAAGCCGGCGGCTACCCGCCTGCCAGCCCGCGCCGCCTGGTTCCTGCAGGAGCTGCCTTCCTTCGCGGTGCCCGCGGGGATCCTCGCCCGGCAGCCCCTCTCCCTCTTCGGGCCACCTGGGACGGTACTTCTGGGCCTCTTCTGCCTACATTACTTCCACAGGACATTTGTGTACTCACTGCTCAATCGAGGGAGGCCTTATCCAGCTATACTCATTCTCAGAGGCACTGCCTTCTGCACTGGAAATGGAGTCCTTCAAGGCTACTATCTGATTTACTGTGCTGAATACCCTGATGGGTGGTACACAGACATACGGTTTAGCTTGGGTGTCTTCTTATTTATTTTGGGAATGGGAATAAACATTCATAGTGACTATATATTGCGCCAGCTCAGGAAGCCTGGAGAAATCAGCTACAGGATTCCACAAGGTGGCTTGTTTACGTATGTTTCTGGAGCCAATTTCCTCGGTGAGATCATTGAATGGATCGGCTATGCCCTGGCCACTTGGTCCCTCCCAGCACTTGCATTTGCATTTTTCTCACTTTGTTTCCTTGGGCTGCGAGCTTTTCACCACCATAGGTTCTACCTCAAGATGTTTGAGGACTACCCCAAATCTCGGAAAGCCCTTATTCCATTCATCTTTTAA
ORF Protein Sequence MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0020-Ab Anti-SRD5A2 monoclonal antibody
    Target Antigen GM-Tg-g-IP0020-Ag SRD5A2 protein
    ORF Viral Vector pGMLP004602 Human SRD5A2 Lentivirus plasmid
    ORF Viral Vector vGMLP004602 Human SRD5A2 Lentivirus particle


    Target information

    Target ID GM-IP0020
    Target Name SRD5A2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6716
    Gene ID 100070655 (Equus caballus), 101086898 (Felis catus), 403715 (Canis lupus familiaris), 527024 (Bos taurus)
    64677 (Rattus norvegicus), 6716 (Homo sapiens), 705676 (Macaca mulatta), 94224 (Mus musculus)
    Gene Symbols & Synonyms SRD5A2,Srd5a2,S5AR 2,5ART2
    Target Alternative Names SRD5A2,3-oxo-5-alpha-steroid 4-dehydrogenase 2,5 alpha-SR2, SR type 2, Steroid 5-alpha-reductase 2 (S5AR 2), Type II 5-alpha reductase
    Uniprot Accession P31213,P31214,Q99N99
    Additional SwissProt Accessions: P31214,P31213,Q99N99
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Prostate disease
    Disease from KEGG Metabolic pathways, Steroid hormone biosynthesis, Prostate cancer
    Gene Ensembl ENSECAG00000024330, ENSCAFG00845012713, ENSBTAG00000003108, ENSG00000277893, ENSMMUG00000058006, ENSMUSG00000038541
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.