Human Rab8a/MEL/RAB8 ORF/cDNA clone-Lentivirus plasmid (NM_005370)

Cat. No.: pGMLP004586
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human Rab8a/MEL/RAB8 Lentiviral expression plasmid for Rab8a lentivirus packaging, Rab8a lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RAB8A/Rab8a/MEL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $456
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004586
Gene Name Rab8a
Accession Number NM_005370
Gene ID 4218
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 624 bp
Gene Alias MEL,RAB8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACGCCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTTTAAAATTAGGACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGCCGGTCAGGAACGGTTTCGGACGATCACAACGGCCTACTACAGGGGTGCAATGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAACATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCTCTGCAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTTCCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAGTTCATGGAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCTCGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGCAACAGCCCCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGGAGCAGCTTTTTCCGATGTGTTCTTCTGTGA
ORF Protein Sequence MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2278-Ab Anti-RAB8A/ MEL/ RAB8 monoclonal antibody
    Target Antigen GM-Tg-g-MP2278-Ag RAB8A VLP (virus-like particle)
    ORF Viral Vector pGMLP004586 Human Rab8a Lentivirus plasmid
    ORF Viral Vector pGMLV001767 Human RAB8A Lentivirus plasmid
    ORF Viral Vector vGMLP004586 Human Rab8a Lentivirus particle
    ORF Viral Vector vGMLV001767 Human RAB8A Lentivirus particle


    Target information

    Target ID GM-MP2278
    Target Name RAB8A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4218
    Gene ID 100125881 (Bos taurus), 100147248 (Equus caballus), 100423251 (Macaca mulatta), 101092668 (Felis catus)
    117103 (Rattus norvegicus), 17274 (Mus musculus), 403773 (Canis lupus familiaris), 4218 (Homo sapiens)
    Gene Symbols & Synonyms RAB8A,Rab8a,Mel,Rab8,RAB8,MEL
    Target Alternative Names MEL,Mel,Oncogene c-mel,RAB8,RAB8A,Rab8,Rab8a,Ras-related protein Rab-8A
    Uniprot Accession A4FV54,P35280,P55258,P61006,P61007
    Additional SwissProt Accessions: A4FV54,P35280,P55258,P61007,P61006
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG Tight junction, Pancreatic secretion
    Gene Ensembl ENSBTAG00000038696, ENSECAG00000053880, ENSMMUG00000056960, ENSMUSG00000003037, ENSCAFG00845030471, ENSG00000167461
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.