Human APLN/APEL/XNPEP2 ORF/cDNA clone-Lentivirus plasmid (NM_017413)
Cat. No.: pGMLP004562
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human APLN/APEL/XNPEP2 Lentiviral expression plasmid for APLN lentivirus packaging, APLN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
Apelin/APLN/APLN/APEL products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004562 |
Gene Name | APLN |
Accession Number | NM_017413 |
Gene ID | 8862 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 234 bp |
Gene Alias | APEL,XNPEP2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAATCTGCGGCTCTGCGTGCAGGCGCTCCTGCTGCTCTGGCTCTCCTTGACCGCGGTGTGTGGAGGGTCCCTGATGCCGCTTCCCGATGGGAATGGGCTGGAAGACGGCAATGTCCGCCACCTGGTGCAGCCCAGAGGGTCAAGGAATGGGCCAGGGCCCTGGCAGGGAGGTCGGAGGAAATTCCGCCGCCAGCGGCCCCGCCTCTCCCATAAGGGACCCATGCCTTTCTGA |
ORF Protein Sequence | MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T58674-Ab | Anti-APEL/ Apelin/ APLN functional antibody |
Target Antigen | GM-Tg-g-T58674-Ag | Apelin/APLN protein |
Cytokine | cks-Tg-g-GM-T58674 | apelin (APLN) protein & antibody |
ORF Viral Vector | pGMLP004562 | Human APLN Lentivirus plasmid |
ORF Viral Vector | vGMLP004562 | Human APLN Lentivirus particle |
Target information
Target ID | GM-T58674 |
Target Name | Apelin/APLN |
Gene Group Identifier (Target Gene ID in Homo species) |
8862 |
Gene ID |
101101295 (Felis catus), 102149746 (Equus caballus), 282143 (Bos taurus), 30878 (Mus musculus) 58812 (Rattus norvegicus), 611497 (Canis lupus familiaris), 702695 (Macaca mulatta), 8862 (Homo sapiens) |
Gene Symbols & Synonyms | APLN,Apln,Apel,6030430G11Rik,APEL,XNPEP2 |
Target Alternative Names | Apelin, APLN,Apelin,APJ endogenous ligand,APEL,XNPEP2 |
Uniprot Accession |
Q9R0R3,Q9R0R4,Q9TUI9,Q9ULZ1
Additional SwissProt Accessions: Q9TUI9,Q9R0R4,Q9R0R3,Q9ULZ1 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Cytokine Target |
Disease | |
Disease from KEGG | Neuroactive ligand-receptor interaction |
Gene Ensembl | ENSECAG00000036591, ENSBTAG00000019993, ENSMUSG00000037010, ENSG00000171388 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.