Human CD53/MOX44/TSPAN25 ORF/cDNA clone-Lentivirus plasmid (NM_000560)

Cat. No.: pGMLP004539
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD53/MOX44/TSPAN25 Lentiviral expression plasmid for CD53 lentivirus packaging, CD53 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CD53/MOX44 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $465
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004539
Gene Name CD53
Accession Number NM_000560
Gene ID 963
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 660 bp
Gene Alias MOX44,TSPAN25
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCATGAGTAGCTTGAAACTGCTGAAGTATGTCCTGTTTTTCTTCAACTTGCTCTTTTGGATCTGTGGCTGCTGCATTTTGGGCTTTGGGATCTACCTGCTGATCCACAACAACTTCGGAGTGCTCTTCCATAACCTCCCCTCCCTCACGCTGGGCAATGTGTTTGTCATCGTGGGCTCTATTATCATGGTAGTTGCCTTCCTGGGCTGCATGGGCTCTATCAAGGAAAACAAGTGTCTGCTTATGTCGTTCTTCATCCTGCTGCTGATTATCCTCCTTGCTGAGGTGACCTTGGCCATCCTGCTCTTTGTATATGAACAGAAGCTGAATGAGTATGTGGCTAAGGGTCTGACCGACAGCATCCACCGTTACCACTCAGACAATAGCACCAAGGCAGCGTGGGACTCCATCCAGTCATTTCTGCAGTGTTGTGGTATAAATGGCACGAGTGATTGGACCAGTGGCCCACCAGCATCTTGCCCCTCAGATCGAAAAGTGGAGGGTTGCTATGCGAAAGCAAGACTGTGGTTTCATTCCAATTTCCTGTATATCGGAATCATCACCATCTGTGTATGTGTGATTGAGGTGTTGGGGATGTCCTTTGCACTGACCCTGAACTGCCAGATTGACAAAACCAGCCAGACCATAGGGCTATGA
ORF Protein Sequence MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0213-Ab Anti-CD53/ MOX44/ TSPAN25 monoclonal antibody
    Target Antigen GM-Tg-g-MP0213-Ag CD53 VLP (virus-like particle)
    ORF Viral Vector pGMLP004539 Human CD53 Lentivirus plasmid
    ORF Viral Vector vGMLP004539 Human CD53 Lentivirus particle


    Target information

    Target ID GM-MP0213
    Target Name CD53
    Gene Group Identifier
    (Target Gene ID in Homo species)
    963
    Gene ID 100058745 (Equus caballus), 100855953 (Canis lupus familiaris), 101084381 (Felis catus), 12508 (Mus musculus)
    24251 (Rattus norvegicus), 505040 (Bos taurus), 702350 (Macaca mulatta), 963 (Homo sapiens)
    Gene Symbols & Synonyms CD53,Cd53,Ox-44,Tspan25,OX44,MOX44,TSPAN25
    Target Alternative Names CD53,Cd53,Cell surface glycoprotein CD53,Leukocyte surface antigen CD53,MOX44,OX44,Ox-44,TSPAN25,Tetraspanin-25 (Tspan-25),Tspan25
    Uniprot Accession P19397,P24485,Q58DM3,Q61451
    Additional SwissProt Accessions: Q61451,P24485,Q58DM3,P19397
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000013534, ENSCAFG00845001785, ENSMUSG00000040747, ENSBTAG00000006466, ENSMMUG00000000811, ENSG00000143119
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.