Human TNFRSF13C/BAFF-R/BAFFR ORF/cDNA clone-Lentivirus plasmid (NM_052945)

Cat. No.: pGMLP004528
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TNFRSF13C/BAFF-R/BAFFR Lentiviral expression plasmid for TNFRSF13C lentivirus packaging, TNFRSF13C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TNFRSF13C/CD268/TNFRSF13C/BAFF-R products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $438.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004528
Gene Name TNFRSF13C
Accession Number NM_052945
Gene ID 115650
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 555 bp
Gene Alias BAFF-R,BAFFR,BROMIX,CD268,CVID4,prolixin
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCGAGGGCCCCGGAGCCTGCGGGGCAGGGACGCGCCAGCCCCCACGCCCTGCGTCCCGGCCGAGTGCTTCGACCTGCTGGTCCGCCACTGCGTGGCCTGCGGGCTCCTGCGCACGCCGCGGCCGAAACCGGCCGGGGCCAGCAGCCCTGCGCCCAGGACGGCGCTGCAGCCGCAGGAGTCGGTGGGCGCGGGGGCCGGCGAGGCGGCGCTGCCCCTGCCCGGGCTGCTCTTTGGCGCCCCCGCGCTGCTGGGCCTGGCACTGGTCCTGGCGCTGGTCCTGGTGGGTCTGGTGAGCTGGAGGCGGCGACAGCGGCGGCTTCGCGGCGCGTCCTCCGCAGAGGCCCCCGACGGAGACAAGGACGCCCCAGAGCCCCTGGACAAGGTCATCATTCTGTCTCCGGGAATCTCTGATGCCACAGCTCCTGCCTGGCCTCCTCCTGGGGAAGACCCAGGAACCACCCCACCTGGCCACAGTGTCCCTGTGCCAGCCACAGAGCTGGGCTCCACTGAACTGGTGACCACCAAGACGGCCGGCCCTGAGCAACAATAG
ORF Protein Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-256 Pre-Made Ianalumab biosimilar, Whole mAb, Anti-TNFRSF13C Antibody: Anti-BAFF-R/BAFFR/BROMIX/CD268/CVID4/prolixin therapeutic antibody
    Target Antibody GM-Tg-g-T83687-Ab Anti-TR13C/ TNFRSF13C/ BAFF-R monoclonal antibody
    Target Antigen GM-Tg-g-T83687-Ag TNFRSF13C VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T83687 tumor necrosis factor receptor superfamily, member 13C (TNFRSF13C) protein & antibody
    ORF Viral Vector pGMLP004528 Human TNFRSF13C Lentivirus plasmid
    ORF Viral Vector vGMLP004528 Human TNFRSF13C Lentivirus particle


    Target information

    Target ID GM-T83687
    Target Name TNFRSF13C/CD268
    Gene Group Identifier
    （Target Gene ID in Homo species)         		115650
    Gene ID 100070724 (Equus caballus), 101090370 (Felis catus), 115650 (Homo sapiens), 500910 (Rattus norvegicus)
    607785 (Canis lupus familiaris), 618516 (Bos taurus), 712577 (Macaca mulatta), 72049 (Mus musculus)
    Gene Symbols & Synonyms TNFRSF13C,Tnfrsf13c,BAFF-R,BAFFR,CD268,CVID4,BROMIX,prolixin,RGD1560810,Bcmd,Baffr,Bcmd1,Bcmd-1,Lvis22,2010006P15Rik
    Target Alternative Names 2010006P15Rik,B-cell-activating factor receptor,BAFF receptor (BAFF-R),BAFF-R,BAFFR,BLyS receptor 3,BROMIX,Baffr,Bcmd,Bcmd-1,Bcmd1,CD268,CVID4,Lvis22,RGD1560810,TNFRSF13C,Tnfrsf13c,Tumor necrosis factor receptor superfamily member 13C,prolixin
    Uniprot Accession Q96RJ3,Q9D8D0
    Additional SwissProt Accessions: Q96RJ3,Q9D8D0
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, NF-kappa B signaling pathway, Intestinal immune network for IgA production, Human T-cell leukemia virus 1 infection
    Gene Ensembl ENSECAG00000031107, ENSG00000159958, ENSMMUG00000052011, ENSMUSG00000068105
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.