Human RAMP2 ORF/cDNA clone-Lentivirus plasmid (NM_005854)

Cat. No.: pGMLP004515
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAMP2/ Lentiviral expression plasmid for RAMP2 lentivirus packaging, RAMP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RAMP2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $432
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004515
Gene Name RAMP2
Accession Number NM_005854
Gene ID 10266
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 528 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTCGCTCCGGGTGGAGCGCGCCGGCGGCCCGCGTCTCCCTAGGACCCGAGTCGGGCGGCCGGCAGCGCTCCGCCTCCTCCTCCTGCTGGGCGCTGTCCTGAATCCCCACGAGGCCCTGGCTCAGCCTCTTCCCACCACAGGCACACCAGGGTCAGAAGGGGGGACGGTGAAGAACTATGAGACAGCTGTCCAATTTTGCTGGAATCATTATAAGGATCAAATGGATCCTATCGAAAAGGATTGGTGCGACTGGGCCATGATTAGCAGGCCTTATAGCACCCTGCGAGATTGCCTGGAGCACTTTGCAGAGTTGTTTGACCTGGGCTTCCCCAATCCCTTGGCAGAGAGGATCATCTTTGAGACTCACCAGATCCACTTTGCCAACTGCTCCCTGGTGCAGCCCACCTTCTCTGACCCCCCAGAGGATGTACTCCTGGCCATGATCATAGCCCCCATCTGCCTCATCCCCTTCCTCATCACTCTTGTAGTATGGAGGAGTAAAGACAGTGAGGCCCAGGCCTAG
ORF Protein Sequence MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1452-Ab Anti-RAMP2 monoclonal antibody
    Target Antigen GM-Tg-g-MP1452-Ag RAMP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP004515 Human RAMP2 Lentivirus plasmid
    ORF Viral Vector vGMLP004515 Human RAMP2 Lentivirus particle


    Target information

    Target ID GM-MP1452
    Target Name RAMP2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10266
    Gene ID 100630685 (Equus caballus), 101092654 (Felis catus), 10266 (Homo sapiens), 480515 (Canis lupus familiaris)
    504230 (Bos taurus), 54409 (Mus musculus), 58966 (Rattus norvegicus), 707718 (Macaca mulatta)
    Gene Symbols & Synonyms RAMP2,Ramp2
    Target Alternative Names Calcitonin-receptor-like receptor activity-modifying protein 2 (CRLR activity-modifying protein 2),RAMP2,Ramp2,Receptor activity-modifying protein 2
    Uniprot Accession O60895,Q9JHJ1,Q9WUP0
    Additional SwissProt Accessions: O60895,Q9WUP0,Q9JHJ1
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Vascular smooth muscle contraction
    Gene Ensembl ENSECAG00000007412, ENSG00000131477, ENSBTAG00000019903, ENSMUSG00000001240, ENSMMUG00000002150
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.