Human PF4/CXCL4/PF-4 ORF/cDNA clone-Lentivirus plasmid (NM_002619)

Cat. No.: pGMLP004508
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PF4/CXCL4/PF-4 Lentiviral expression plasmid for PF4 lentivirus packaging, PF4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PF4/CXCL4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004508
Gene Name PF4
Accession Number NM_002619
Gene ID 5196
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 306 bp
Gene Alias CXCL4,PF-4,SCYB4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCTCCGCAGCCGGGTTCTGCGCCTCACGCCCCGGGCTGCTGTTCCTGGGGTTGCTGCTCCTGCCACTTGTGGTCGCCTTCGCCAGCGCTGAAGCTGAAGAAGATGGGGACCTGCAGTGCCTGTGTGTGAAGACCACCTCCCAGGTCCGTCCCAGGCACATCACCAGCCTGGAGGTGATCAAGGCCGGACCCCACTGCCCCACTGCCCAACTGATAGCCACGCTGAAGAATGGAAGGAAAATTTGCTTGGACCTGCAAGCCCCGCTGTACAAGAAAATAATTAAGAAACTTTTGGAGAGTTAG
ORF Protein Sequence MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T30827-Ab Anti-PLF4/ PF4/ CXCL4 functional antibody
    Target Antigen GM-Tg-g-T30827-Ag PF4 protein
    Cytokine cks-Tg-g-GM-T30827 platelet factor 4 (PF4) protein & antibody
    ORF Viral Vector pGMLP004508 Human PF4 Lentivirus plasmid
    ORF Viral Vector vGMLP004508 Human PF4 Lentivirus particle


    Target information

    Target ID GM-T30827
    Target Name PF4
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5196
    Gene ID 100630489 (Equus caballus), 360918 (Rattus norvegicus), 507790 (Bos taurus), 5196 (Homo sapiens)
    56744 (Mus musculus), 703451 (Macaca mulatta)
    Gene Symbols & Synonyms LOC100630489,Pf4,PF4,PF-4,Pf4a,Cxcl4,RATPF4A,CXCL4,SCYB4,Scyb4
    Target Alternative Names PF4,Platelet factor 4,PF-4,C-X-C motif chemokine 4, Iroplact, Oncostatin-A,PF-4,CXCL4,SCYB4
    Uniprot Accession P02776,P02777,P06765,Q9Z126
    Additional SwissProt Accessions: P06765,P02777,P02776,Q9Z126
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway
    Gene Ensembl ENSECAG00000012560, ENSG00000163737, ENSMUSG00000029373, ENSMMUG00000058452
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.