Human OXT/OT/OT-NPI ORF/cDNA clone-Lentivirus plasmid (NM_000915)

Cat. No.: pGMLP004507
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human OXT/OT/OT-NPI Lentiviral expression plasmid for OXT lentivirus packaging, OXT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to OXT/OT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004507
Gene Name OXT
Accession Number NM_000915
Gene ID 5020
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 378 bp
Gene Alias OT,OT-NPI,OXT-NPI
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGGCCCCAGCCTCGCTTGCTGTCTGCTCGGCCTCCTGGCGCTGACCTCCGCCTGCTACATCCAGAACTGCCCCCTGGGAGGCAAGAGGGCCGCGCCGGACCTCGACGTGCGCAAGTGCCTCCCCTGCGGCCCCGGGGGCAAAGGCCGCTGCTTCGGGCCCAATATCTGCTGCGCGGAAGAGCTGGGCTGCTTCGTGGGCACCGCCGAAGCGCTGCGCTGCCAGGAGGAGAACTACCTGCCGTCGCCCTGCCAGTCCGGCCAGAAGGCGTGCGGGAGCGGGGGCCGCTGCGCGGTCTTGGGCCTCTGCTGCAGCCCGGACGGCTGCCACGCCGACCCTGCCTGCGACGCGGAAGCCACCTTCTCCCAGCGCTGA
ORF Protein Sequence MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1165-Ab Anti-NEU1/ OXT/ OT functional antibody
    Target Antigen GM-Tg-g-SE1165-Ag OXT protein
    ORF Viral Vector pGMLP004507 Human OXT Lentivirus plasmid
    ORF Viral Vector vGMLP004507 Human OXT Lentivirus particle


    Target information

    Target ID GM-SE1165
    Target Name OXT
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5020
    Gene ID 100856247 (Canis lupus familiaris), 111559702 (Felis catus), 111767489 (Equus caballus), 18429 (Mus musculus)
    25504 (Rattus norvegicus), 280888 (Bos taurus), 5020 (Homo sapiens), 717068 (Macaca mulatta)
    Gene Symbols & Synonyms OXT,Oxt,OT,Oxy,OTNPI,OT-NPI,OXT-NPI
    Target Alternative Names OT,OT-NPI,OTNPI,OXT,OXT-NPI,Oxt,Oxy,Oxytocin-neurophysin 1
    Uniprot Accession P01175,P01178,P01179,P35454
    Additional SwissProt Accessions: P35454,P01179,P01175,P01178
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG cAMP signaling pathway, Neuroactive ligand-receptor interaction, Oxytocin signaling pathway
    Gene Ensembl ENSECAG00000034091, ENSMUSG00000027301, ENSBTAG00000008026, ENSG00000101405, ENSMMUG00000010678
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.