Human IGFBP1/AFBP/hIGFBP-1 ORF/cDNA clone-Lentivirus plasmid (NM_000596)

Cat. No.: pGMLP004491
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IGFBP1/AFBP/hIGFBP-1 Lentiviral expression plasmid for IGFBP1 lentivirus packaging, IGFBP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IGFBP1/IGFBP-1/IGFBP1/AFBP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $495
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004491
Gene Name IGFBP1
Accession Number NM_000596
Gene ID 3484
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 780 bp
Gene Alias AFBP,hIGFBP-1,IBP1,IGF-BP25,PP12
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCAGAGGTCCCCGTTGCTCGCGTCTGGCTGGTACTGCTCCTGCTGACTGTCCAGGTCGGCGTGACAGCCGGCGCTCCGTGGCAGTGCGCGCCCTGCTCCGCCGAGAAGCTCGCGCTCTGCCCGCCGGTGTCCGCCTCGTGCTCGGAGGTCACCCGGTCCGCCGGCTGCGGCTGTTGCCCGATGTGCGCCCTGCCTCTGGGCGCCGCGTGCGGCGTGGCGACTGCACGCTGCGCCCGGGGACTCAGTTGCCGCGCGCTGCCGGGGGAGCAGCAACCTCTGCACGCCCTCACCCGCGGCCAAGGCGCCTGCGTGCAGGAGTCTGACGCCTCCGCTCCCCATGCTGCAGAGGCAGGGAGCCCTGAAAGCCCAGAGAGCACGGAGATAACTGAGGAGGAGCTCCTGGATAATTTCCATCTGATGGCCCCTTCTGAAGAGGATCATTCCATCCTTTGGGACGCCATCAGTACCTATGATGGCTCGAAGGCTCTCCATGTCACCAACATCAAAAAATGGAAGGAGCCCTGCCGAATAGAACTCTACAGAGTCGTAGAGAGTTTAGCCAAGGCACAGGAGACATCAGGAGAAGAAATTTCCAAATTTTACCTGCCAAACTGCAACAAGAATGGATTTTATCACAGCAGACAGTGTGAGACATCCATGGATGGAGAGGCGGGACTCTGCTGGTGCGTCTACCCTTGGAATGGGAAGAGGATCCCTGGGTCTCCAGAGATCAGGGGAGACCCCAACTGCCAGATATATTTTAATGTACAAAACTGA
ORF Protein Sequence MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T15048-Ab Anti-IBP1/ IGFBP1/ AFBP functional antibody
    Target Antigen GM-Tg-g-T15048-Ag IGFBP1 protein
    Cytokine cks-Tg-g-GM-T15048 insulin-like growth factor binding protein 1 (IGFBP1) protein & antibody
    ORF Viral Vector pGMLP004491 Human IGFBP1 Lentivirus plasmid
    ORF Viral Vector vGMLP004491 Human IGFBP1 Lentivirus particle


    Target information

    Target ID GM-T15048
    Target Name IGFBP1/IGFBP-1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3484
    Gene ID 100034154 (Equus caballus), 101101629 (Felis catus), 16006 (Mus musculus), 25685 (Rattus norvegicus)
    282259 (Bos taurus), 3484 (Homo sapiens), 480812 (Canis lupus familiaris), 696994 (Macaca mulatta)
    Gene Symbols & Synonyms IGFBP1,Igfbp1,IGFBP-1,IBP1,IGFBA,IGF-BP25,AFBP,PP12,hIGFBP-1
    Target Alternative Names AFBP,IBP-1,IBP1,IGF-BP25,IGF-binding protein 1,IGFBA,IGFBP-1,IGFBP1,Igfbp1,Insulin-like growth factor-binding protein 1,PP12,Placental protein 12 (PP12),hIGFBP-1
    Uniprot Accession P08833,P21743,P24591,P47876
    Additional SwissProt Accessions: P47876,P21743,P24591,P08833
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker, Cytokine Target
    Disease cancer, Ovary Cancer, Non-small cell lung carcinoma
    Disease from KEGG
    Gene Ensembl ENSECAG00000014889, ENSMUSG00000020429, ENSBTAG00000046768, ENSG00000146678, ENSCAFG00845011343, ENSMMUG00000059330
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.