Human FGF7/HBGF-7/KGF ORF/cDNA clone-Lentivirus plasmid (NM_002009)

Cat. No.: pGMLP004482
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FGF7/HBGF-7/KGF Lentiviral expression plasmid for FGF7 lentivirus packaging, FGF7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to FGF7/HBGF-7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $446.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004482
Gene Name FGF7
Accession Number NM_002009
Gene ID 2252
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 585 bp
Gene Alias HBGF-7,KGF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCACAAATGGATACTGACATGGATCCTGCCAACTTTGCTCTACAGATCATGCTTTCACATTATCTGTCTAGTGGGTACTATATCTTTAGCTTGCAATGACATGACTCCAGAGCAAATGGCTACAAATGTGAACTGTTCCAGCCCTGAGCGACACACAAGAAGTTATGATTACATGGAAGGAGGGGATATAAGAGTGAGAAGACTCTTCTGTCGAACACAGTGGTACCTGAGGATCGATAAAAGAGGCAAAGTAAAAGGGACCCAAGAGATGAAGAATAATTACAATATCATGGAAATCAGGACAGTGGCAGTTGGAATTGTGGCAATCAAAGGGGTGGAAAGTGAATTCTATCTTGCAATGAACAAGGAAGGAAAACTCTATGCAAAGAAAGAATGCAATGAAGATTGTAACTTCAAAGAACTAATTCTGGAAAACCATTACAACACATATGCATCAGCTAAATGGACACACAACGGAGGGGAAATGTTTGTTGCCTTAAATCAAAAGGGGATTCCTGTAAGAGGAAAAAAAACGAAGAAAGAACAAAAAACAGCCCACTTTCTTCCTATGGCAATAACTTAA
ORF Protein Sequence MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T19852-Ab Anti-FGF7/ HBGF-7/ KGF functional antibody
    Target Antigen GM-Tg-g-T19852-Ag FGF7 protein
    Cytokine cks-Tg-g-GM-T19852 fibroblast growth factor 7 (FGF7) protein & antibody
    ORF Viral Vector pGMLP004482 Human FGF7 Lentivirus plasmid
    ORF Viral Vector vGMLP004482 Human FGF7 Lentivirus particle


    Target information

    Target ID GM-T19852
    Target Name FGF7
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2252
    Gene ID 100033961 (Equus caballus), 101097982 (Felis catus), 14178 (Mus musculus), 2252 (Homo sapiens)
    29348 (Rattus norvegicus), 403915 (Canis lupus familiaris), 574345 (Macaca mulatta), 616885 (Bos taurus)
    Gene Symbols & Synonyms FGF7,Fgf7,FGF5B,Kgf,Fgf5b,KGF,HBGF-7,KGF/FGF7
    Target Alternative Names FGF-7,FGF5B,FGF7,Fgf5b,Fgf7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7 (HBGF-7),KGF,KGF/FGF7,Keratinocyte growth factor,Kgf
    Uniprot Accession P21781,P36363,P79150,Q02195
    Additional SwissProt Accessions: P36363,P21781,Q02195,P79150
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer, Acute respiratory distress syndrome (ARDS)
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSECAG00000015510, ENSMUSG00000027208, ENSG00000140285, ENSCAFG00845022021, ENSMMUG00000009842, ENSBTAG00000051898
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.