Human ICOS/AILIM/CD278 ORF/cDNA clone-Lentivirus plasmid (NM_012092)

Cat. No.: pGMLP004459
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ICOS/AILIM/CD278 Lentiviral expression plasmid for ICOS lentivirus packaging, ICOS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ICOS/CD278/ICOS/AILIM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004459
Gene Name ICOS
Accession Number NM_012092
Gene ID 29851
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 600 bp
Gene Alias AILIM,CD278,CVID1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGTCAGGCCTCTGGTATTTCTTTCTCTTCTGCTTGCGCATTAAAGTTTTAACAGGAGAAATCAATGGTTCTGCCAATTATGAGATGTTTATATTTCACAACGGAGGTGTACAAATTTTATGCAAATATCCTGACATTGTCCAGCAATTTAAAATGCAGTTGCTGAAAGGGGGGCAAATACTCTGCGATCTCACTAAGACAAAAGGAAGTGGAAACACAGTGTCCATTAAGAGTCTGAAATTCTGCCATTCTCAGTTATCCAACAACAGTGTCTCTTTTTTTCTATACAACTTGGACCATTCTCATGCCAACTATTACTTCTGCAACCTATCAATTTTTGATCCTCCTCCTTTTAAAGTAACTCTTACAGGAGGATATTTGCATATTTATGAATCACAACTTTGTTGCCAGCTGAAGTTCTGGTTACCCATAGGATGTGCAGCCTTTGTTGTAGTCTGCATTTTGGGATGCATACTTATTTGTTGGCTTACAAAAAAGAAGTATTCATCCAGTGTGCACGACCCTAACGGTGAATACATGTTCATGAGAGCAGTGAACACAGCCAAAAAATCTAGACTCACAGATGTGACCCTATAA
ORF Protein Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-629 Pre-Made Vopratelimab biosimilar, Whole mAb, Anti-ICOS Antibody: Anti-AILIM/CD278/CVID1 therapeutic antibody
    Biosimilar GMP-Bios-ab-017 Pre-Made Alomfilimab biosimilar, Whole mAb, Anti-ICOS Antibody: Anti-AILIM/CD278/CVID1 therapeutic antibody
    Biosimilar GMP-Bios-ab-207 Pre-Made Feladilimab biosimilar, Whole mAb, Anti-ICOS Antibody: Anti-AILIM/CD278/CVID1 therapeutic antibody
    Biosimilar GMP-Bios-ab-499 Pre-Made Rozibafusp biosimilar, Whole mAb Fusion, Anti-ICOS Antibody: Anti-AILIM/CD278/CVID1 therapeutic antibody
    Biosimilar GMP-Bios-INN-982 Pre-Made Rozibafusp Alfa Biosimilar, Fusion Protein targeting ICOS fused with human TNFSF13B (tumor necrosis factor (TNF) superfamily member 13B, BAFF, THANK, TALL1, TALL-1, BLYS, BLyS, B cell activating factor, B lymphocyte activator, CD257): Recombinant therapeutic protein targeting AILIM/CD278/CVID1
    Biosimilar GMP-Bios-ab-287 Pre-Made Izuralimab biosimilar, Bispecific Mixed mAb and scFv, Anti-ICOS;PDCD1/PD-1 antibody: Anti-AILIM/CD278/CVID1;CD279/SLEB2/hPD-1/hPD-l/hSLE1 therapeutic antibody
    Target Antibody GM-Tg-g-T62705-Ab Anti-ICOS/ AILIM/ CD278 monoclonal antibody
    Target Antigen GM-Tg-g-T62705-Ag ICOS VLP (virus-like particle)
    ORF Viral Vector pGMLP004459 Human ICOS Lentivirus plasmid
    ORF Viral Vector vGMLP004459 Human ICOS Lentivirus particle


    Target information

    Target ID GM-T62705
    Target Name ICOS/CD278
    Gene Group Identifier
    （Target Gene ID in Homo species)         		29851
    Gene ID 100067953 (Equus caballus), 101089031 (Felis catus), 29851 (Homo sapiens), 403456 (Canis lupus familiaris)
    507026 (Bos taurus), 54167 (Mus musculus), 64545 (Rattus norvegicus), 705788 (Macaca mulatta)
    Gene Symbols & Synonyms ICOS,Icos,AILIM,CD278,CVID1,H4,CCLP,CRP-1,Ly115,Ailim
    Target Alternative Names AILIM,Activation-inducible lymphocyte immunomediatory molecule,Ailim,CCLP,CD278,CRP-1,CVID1,H4,ICOS,Icos,Inducible T-cell costimulator,Ly115
    Uniprot Accession Q58DF9,Q7YR73,Q9R1T7,Q9WVS0,Q9Y6W8
    Additional SwissProt Accessions: Q9Y6W8,Q7YR73,Q58DF9,Q9WVS0,Q9R1T7
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease cancer
    Disease from KEGG Cell adhesion molecules, T cell receptor signaling pathway, Intestinal immune network for IgA production
    Gene Ensembl ENSECAG00000006253, ENSG00000163600, ENSCAFG00845018403, ENSBTAG00000021596, ENSMUSG00000026009, ENSMMUG00000002648
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.