Human CLEC11A/CLECSF3/LSLCL ORF/cDNA clone-Lentivirus plasmid (NM_002975)

Cat. No.: pGMLP004448
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLEC11A/CLECSF3/LSLCL Lentiviral expression plasmid for CLEC11A lentivirus packaging, CLEC11A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CLEC11A/SCGF/CLEC11A/CLECSF3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $543
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004448
Gene Name CLEC11A
Accession Number NM_002975
Gene ID 6320
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 972 bp
Gene Alias CLECSF3,LSLCL,P47,SCGF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGCAGCCTGGCTTTTGGGGGCTTTGGTGGTCCCCCAGCTCTTGGGCTTTGGCCATGGGGCTCGGGGAGCAGAGAGGGAGTGGGAGGGAGGCTGGGGAGGTGCCCAGGAGGAGGAGCGGGAGAGGGAGGCCCTGATGCTGAAGCATCTGCAGGAAGCCCTAGGACTGCCTGCTGGGAGGGGGGATGAGAATCCTGCCGGAACTGTTGAGGGAAAAGAGGACTGGGAGATGGAGGAGGACCAGGGGGAGGAAGAGGAGGAGGAAGCAACGCCAACCCCATCCTCCGGCCCCAGCCCCTCTCCCACCCCTGAGGACATCGTCACTTACATCCTGGGCCGCCTGGCCGGCCTGGACGCAGGCCTGCACCAGCTGCACGTCCGTCTGCACGCGTTGGACACCCGCGTGGTCGAGCTGACCCAGGGGCTGCGGCAGCTGCGGAACGCGGCAGGCGACACCCGCGATGCCGTGCAAGCCCTGCAGGAGGCGCAGGGTCGCGCCGAGCGCGAGCACGGCCGCTTGGAGGGCTGCCTGAAGGGGCTGCGCCTGGGCCACAAGTGCTTCCTGCTCTCGCGCGACTTCGAAGCTCAGGCGGCGGCGCAGGCGCGGTGCACGGCGCGGGGCGGGAGCCTGGCGCAGCCGGCAGACCGCCAGCAGATGGAGGCGCTCACTCGGTACCTGCGCGCGGCGCTCGCTCCCTACAACTGGCCCGTGTGGCTGGGCGTGCACGATCGGCGCGCCGAGGGCCTCTACCTCTTCGAAAACGGCCAGCGCGTGTCCTTCTTCGCCTGGCATCGCTCACCCCGCCCCGAGCTCGGCGCCCAGCCCAGCGCCTCGCCGCATCCGCTCAGCCCGGACCAGCCCAACGGTGGCACGCTCGAGAACTGCGTGGCGCAGGCCTCTGACGACGGCTCCTGGTGGGACCACGACTGCCAGCGGCGTCTCTACTACGTCTGCGAGTTCCCCTTCTAG
ORF Protein Sequence MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0781-Ab Anti-CLC11/ CLEC11A/ CLECSF3 functional antibody
    Target Antigen GM-Tg-g-SE0781-Ag CLEC11A protein
    ORF Viral Vector pGMLP004448 Human CLEC11A Lentivirus plasmid
    ORF Viral Vector vGMLP004448 Human CLEC11A Lentivirus particle


    Target information

    Target ID GM-SE0781
    Target Name CLEC11A/SCGF
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6320
    Gene ID 101087888 (Felis catus), 111775249 (Equus caballus), 20256 (Mus musculus), 29313 (Rattus norvegicus)
    522611 (Bos taurus), 611817 (Canis lupus familiaris), 6320 (Homo sapiens), 719381 (Macaca mulatta)
    Gene Symbols & Synonyms CLEC11A,Clec11a,Scgf,Clecsf3,P47,SCGF,LSLCL,CLECSF3
    Target Alternative Names CLEC11A, SCGF,C-type lectin domain family 11 member A,C-type lectin superfamily member 3, Lymphocyte secreted C-type lectin, Osteolectin, Stem cell growth factor, p47,P47,SCGF,LSLCL,CLECSF3
    Uniprot Accession O88200,O88201,Q9Y240
    Additional SwissProt Accessions: O88200,O88201,Q9Y240
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000037707, ENSMUSG00000004473, ENSBTAG00000005576, ENSG00000105472, ENSMMUG00000002407
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.