Human CD7/GP40/LEU-9 ORF/cDNA clone-Lentivirus plasmid (NM_006137)

Cat. No.: pGMLP004335
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD7/GP40/LEU-9 Lentiviral expression plasmid for CD7 lentivirus packaging, CD7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CD7/GP40 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $480.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004335
Gene Name CD7
Accession Number NM_006137
Gene ID 924
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 723 bp
Gene Alias GP40,LEU-9,Tp40,TP41
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGGGCCTCCGAGGCTCCTGCTGCTGCCCCTGCTTCTGGCGCTGGCTCGCGGCCTGCCTGGGGCCCTGGCTGCCCAAGAGGTGCAGCAGTCTCCCCACTGCACGACTGTCCCCGTGGGAGCCTCCGTCAACATCACCTGCTCCACCAGCGGGGGCCTGCGTGGGATCTACCTGAGGCAGCTCGGGCCACAGCCCCAAGACATCATTTACTACGAGGACGGGGTGGTGCCCACTACGGACAGACGGTTCCGGGGCCGCATCGACTTCTCAGGGTCCCAGGACAACCTGACTATCACCATGCACCGCCTGCAGCTGTCGGACACTGGCACCTACACCTGCCAGGCCATCACGGAGGTCAATGTCTACGGCTCCGGCACCCTGGTCCTGGTGACAGAGGAACAGTCCCAAGGATGGCACAGATGCTCGGACGCCCCACCAAGGGCCTCTGCCCTCCCTGCCCCACCGACAGGCTCCGCCCTCCCTGACCCGCAGACAGCCTCTGCCCTCCCTGACCCGCCAGCAGCCTCTGCCCTCCCTGCGGCCCTGGCGGTGATCTCCTTCCTCCTCGGGCTGGGCCTGGGGGTGGCGTGTGTGCTGGCGAGGACACAGATAAAGAAACTGTGCTCGTGGCGGGATAAGAATTCGGCGGCATGTGTGGTGTACGAGGACATGTCGCACAGCCGCTGCAACACGCTGTCCTCCCCCAACCAGTACCAGTGA
ORF Protein Sequence MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-858 Pre-Made Grisnilimab Setaritox Biosimilar, Whole Mab Adc, Anti-Cd7 Antibody: Anti-GP40/LEU-9/TP41/Tp40 therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-ab-254 Pre-Made Grisnilimab biosimilar, Whole mAb, Anti-CD7 Antibody: Anti-GP40/TP41/Tp40/LEU-9 therapeutic antibody
    Target Antibody GM-Tg-g-T66266-Ab Anti-CD7/ GP40/ LEU-9 monoclonal antibody
    Target Antigen GM-Tg-g-T66266-Ag CD7 VLP (virus-like particle)
    ORF Viral Vector pGMLP004335 Human CD7 Lentivirus plasmid
    ORF Viral Vector vGMLP004335 Human CD7 Lentivirus particle


    Target information

    Target ID GM-T66266
    Target Name CD7
    Gene Group Identifier
    (Target Gene ID in Homo species)
    924
    Gene ID 12516 (Mus musculus), 303747 (Rattus norvegicus), 493848 (Felis catus), 510073 (Bos taurus)
    607675 (Canis lupus familiaris), 719501 (Macaca mulatta), 924 (Homo sapiens)
    Gene Symbols & Synonyms Cd7,CD7,GP40,TP41,Tp40,LEU-9
    Target Alternative Names CD7,Cd7,GP40,LEU-9,T-cell antigen CD7,T-cell leukemia antigen,T-cell surface antigen Leu-9,TP41,Tp40
    Uniprot Accession P09564,P50283
    Additional SwissProt Accessions: P50283,P09564
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease
    Disease from KEGG Hematopoietic cell lineage
    Gene Ensembl ENSMUSG00000025163, ENSBTAG00000011359, ENSCAFG00845007073, ENSMMUG00000064781, ENSG00000173762
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.