Human TBC1D10C/CARABIN/EPI64C ORF/cDNA clone-Lentivirus plasmid (NM_198517)

Cat. No.: pGMLP004136
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TBC1D10C/CARABIN/EPI64C Lentiviral expression plasmid for TBC1D10C lentivirus packaging, TBC1D10C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TBC1D10C/CARABIN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $675.48
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004136
Gene Name TBC1D10C
Accession Number NM_198517
Gene ID 374403
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1341 bp
Gene Alias CARABIN,EPI64C
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCAGGCCCTGGGGGAGGACCTGGTGCAGCCTCCCGAGCTGCAGGATGACTCCAGCTCCTTGGGGTCCGACTCAGAGCTCAGCGGGCCTGGCCCATATCGCCAGGCCGACCGCTATGGATTCATTGGGGGCAGCTCAGCAGAGCCAGGGCCGGGCCACCCACCTGCAGACCTCATCCGCCAACGGGAGATGAAGTGGGTGGAGATGACCTCGCACTGGGAGAAAACCATGTCCCGGCGGTACAAGAAGGTAAAGATGCAGTGCCGGAAAGGCATCCCGTCTGCCCTGCGCGCCCGATGCTGGCCCCTGTTGTGTGGGGCCCATGTGTGCCAGAAGAACAGCCCTGGCACCTATCAGGAGCTGGCAGAGGCCCCTGGAGACCCACAGTGGATGGAGACCATTGGCAGGGACCTGCACCGTCAATTCCCTCTGCACGAGATGTTTGTGTCGCCTCAGGGCCACGGGCAGCAGGGGCTCCTGCAGGTGCTCAAGGCCTACACCCTGTATCGACCGGAGCAGGGCTACTGCCAGGCCCAGGGGCCCGTGGCTGCTGTGCTGCTCATGCACCTGCCCCCAGAGGAGGCCTTCTGGTGCCTGGTGCAGATCTGTGAGGTCTACCTCCCTGGGTACTACGGGCCCCACATGGAGGCTGTGCGGCTGGACGCCGAGGTGTTCATGGCCCTGCTGCGGCGGCTGCTTCCGCACGTGCACAAGCACCTGCAGCAGGTGGGCGTCGGACCCCTGCTGTACCTGCCCGAGTGGTTCCTGTGCCTCTTCGCCCGCTCCCTGCCCTTCCCCACAGTGCTGCGTGTCTGGGATGCCTTCCTCAGTGAGGGTGCCAGAGTACTGTTCCGTGTGGGGCTGACACTGGTGCGCCTGGCGCTGGGCACTGCAGAGCAGCGAGGGGCCTGCCCTGGCCTCCTGGAGACACTGGGAGCCCTTCGAGCCATCCCCCCCGCGCAGCTGCAGGAGGAGGCCTTCATGTCACAGGTGCACAGCGTGGTGCTGTCAGAGCGGGACCTGCAGCGGGAGATCAAGGCCCAGCTGGCCCAGCTGCCCGATTCCGCGCCGGGACCCCCGCCCCGGCCACAGGTCCGCCTCGCCGGGGCCCAAGCCATCTTTGAGGCCCAGCAGCTGGCAGGAGTGCGACGAGGCGCCAAGCCTGAGGTGCCTCGGATTGTGGTGCAGCCCCCGGAGGAGCCCAGACCACCGCGGCGGAAACCCCAGACCCGCGGCAAGACTTTCCATGGGCTCCTGACTCGGGCCCGGGGCCCCCCCATCGAGGGGCCCCCCAGGCCCCAACGAGGCTCCACCTCCTTCCTGGACACCCGCTTCTGA
ORF Protein Sequence MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQGPVAAVLLMHLPPEEAFWCLVQICEVYLPGYYGPHMEAVRLDAEVFMALLRRLLPHVHKHLQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEGARVLFRVGLTLVRLALGTAEQRGACPGLLETLGALRAIPPAQLQEEAFMSQVHSVVLSERDLQREIKAQLAQLPDSAPGPPPRPQVRLAGAQAIFEAQQLAGVRRGAKPEVPRIVVQPPEEPRPPRRKPQTRGKTFHGLLTRARGPPIEGPPRPQRGSTSFLDTRF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1782-Ab Anti-TB10C/ TBC1D10C/ CARABIN monoclonal antibody
    Target Antigen GM-Tg-g-MP1782-Ag TBC1D10C VLP (virus-like particle)
    ORF Viral Vector pGMLP004136 Human TBC1D10C Lentivirus plasmid
    ORF Viral Vector pGMPC001252 Human TBC1D10C Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004136 Human TBC1D10C Lentivirus particle


    Target information

    Target ID GM-MP1782
    Target Name TBC1D10C
    Gene Group Identifier
    (Target Gene ID in Homo species)
    374403
    Gene ID 100146355 (Equus caballus), 101091561 (Felis catus), 108995 (Mus musculus), 361697 (Rattus norvegicus)
    374403 (Homo sapiens), 520599 (Bos taurus), 610509 (Canis lupus familiaris), 712270 (Macaca mulatta)
    Gene Symbols & Synonyms TBC1D10C,Tbc1d10c,1810062O14Rik,RGD1311490,EPI64C,CARABIN,carabin
    Target Alternative Names 1810062O14Rik,CARABIN,Carabin,EPI64C,RGD1311490,TBC1 domain family member 10C,TBC1D10C,Tbc1d10c,carabin
    Uniprot Accession Q8C9V1,Q8IV04
    Additional SwissProt Accessions: Q8C9V1,Q8IV04
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000012029, ENSMUSG00000040247, ENSG00000175463, ENSBTAG00000013133, ENSCAFG00845010400, ENSMMUG00000017280
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.