Human SORD/HEL-S-95n/SORD1 ORF/cDNA clone-Lentivirus plasmid (NM_003104.5)

Cat. No.: pGMLP004060
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SORD/HEL-S-95n/SORD1 Lentiviral expression plasmid for SORD lentivirus packaging, SORD lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SORD/Sorbitol dehydrogenase/SORD/HEL-S-95n products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $600.72
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004060
Gene Name SORD
Accession Number NM_003104.5
Gene ID 6652
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1074 bp
Gene Alias HEL-S-95n,SORD1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGGCGGCCAAGCCCAACAACCTTTCCCTGGTGGTGCACGGACCGGGGGACTTGCGCCTGGAGAACTATCCTATCCCTGAACCAGGCCCAAATGAGGTCTTGCTGAGGATGCATTCTGTTGGAATCTGTGGCTCAGATGTCCACTACTGGGAGTATGGTCGAATTGGGAATTTTATTGTGAAAAAGCCCATGGTGCTGGGACATGAAGCTTCGGGAACAGTCGAAAAAGTGGGATCATCGGTAAAGCACCTAAAACCAGGTGATCGTGTTGCCATCGAGCCTGGTGCTCCCCGAGAAAATGATGAATTCTGCAAGATGGGCCGATACAATCTGTCACCTTCCATCTTCTTCTGTGCCACGCCCCCCGATGACGGGAACCTCTGCCGGTTCTATAAGCACAATGCAGCCTTTTGTTACAAGCTTCCTGACAATGTCACCTTTGAGGAAGGCGCCCTGATCGAGCCACTTTCTGTGGGGATCCATGCCTGCAGGAGAGGCGGAGTTACCCTGGGACACAAGGTCCTTGTGTGTGGAGCTGGGCCAATCGGGATGGTCACTTTGCTCGTGGCCAAAGCAATGGGAGCAGCTCAAGTAGTGGTGACTGATCTGTCTGCTACCCGATTGTCCAAAGCCAAGGAGATTGGGGCTGATTTAGTCCTCCAGATCTCCAAGGAGAGCCCTCAGGAAATCGCCAGGAAAGTAGAAGGTCAGCTGGGGTGCAAGCCGGAAGTCACCATCGAGTGCACGGGGGCAGAGGCCTCCATCCAGGCGGGCATCTACGCCACTCGCTCTGGTGGGAACCTCGTGCTTGTGGGGCTGGGCTCTGAGATGACCACCGTACCCCTACTGCATGCAGCCATCCGGGAGGTGGATATCAAGGGCGTGTTTCGATACTGCAACACGTGGCCAGTGGCGATTTCGATGCTTGCGTCCAAGTCTGTGAATGTAAAACCCCTCGTCACCCATAGGTTTCCTCTGGAGAAAGCTCTGGAGGCCTTTGAAACATTTAAAAAGGGATTGGGGTTGAAAATCATGCTCAAGTGTGACCCCAGTGACCAGAATCCCTGA
ORF Protein Sequence MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T59445-Ab Anti-SORD monoclonal antibody
    Target Antigen GM-Tg-g-T59445-Ag SORD protein
    ORF Viral Vector pGMLP001225 Human SORD Lentivirus plasmid
    ORF Viral Vector pGMLP004060 Human SORD Lentivirus plasmid
    ORF Viral Vector pGMLP004073 Human SORD Lentivirus plasmid
    ORF Viral Vector vGMLP001225 Human SORD Lentivirus particle
    ORF Viral Vector vGMLP004060 Human SORD Lentivirus particle
    ORF Viral Vector vGMLP004073 Human SORD Lentivirus particle


    Target information

    Target ID GM-T59445
    Target Name SORD/Sorbitol dehydrogenase
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6652
    Gene ID 100070575 (Equus caballus), 101088085 (Felis catus), 20322 (Mus musculus), 24788 (Rattus norvegicus)
    487535 (Canis lupus familiaris), 508954 (Bos taurus), 6652 (Homo sapiens), 712784 (Macaca mulatta)
    Gene Symbols & Synonyms SORD,Sord,SDH,XDH,Sdh1,Sdh-1,Sodh-1,RDH,HMNR8,SORD1,SORDD,HEL-S-95n
    Target Alternative Names SORD, Sorbitol dehydrogenase,Sorbitol dehydrogenase,SDH,(R,R)-butanediol dehydrogenase, L-iditol 2-dehydrogenase, Polyol dehydrogenase, Ribitol dehydrogenase (RDH), Xylitol dehydrogenase (XDH),RDH,SDH,XDH,HMNR8,SORD1,SORDD,HEL-S-95n
    Uniprot Accession P27867,Q00796,Q58D31,Q64442
    Additional SwissProt Accessions: Q64442,P27867,Q58D31,Q00796
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Metabolic pathways, Pentose and glucuronate interconversions
    Gene Ensembl ENSECAG00000005266, ENSMUSG00000027227, ENSCAFG00845028851, ENSBTAG00000025496, ENSG00000140263, ENSMMUG00000015971
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.