Human SPI1/OF/PU.1 ORF/cDNA clone-Lentivirus plasmid (NM_003120)

Cat. No.: pGMLP003970
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SPI1/OF/PU.1 Lentiviral expression plasmid for SPI1 lentivirus packaging, SPI1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SPI1/OF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $503.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003970
Gene Name SPI1
Accession Number NM_003120
Gene ID 6688
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 813 bp
Gene Alias OF,PU.1,SFPI1,SPI-1,SPI-A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTACAGGCGTGCAAAATGGAAGGGTTTCCCCTCGTCCCCCCTCCATCAGAAGACCTGGTGCCCTATGACACGGATCTATACCAACGCCAAACGCACGAGTATTACCCCTATCTCAGCAGTGATGGGGAGAGCCATAGCGACCATTACTGGGACTTCCACCCCCACCACGTGCACAGCGAGTTCGAGAGCTTCGCCGAGAACAACTTCACGGAGCTCCAGAGCGTGCAGCCCCCGCAGCTGCAGCAGCTCTACCGCCACATGGAGCTGGAGCAGATGCACGTCCTCGATACCCCCATGGTGCCACCCCATCCCAGTCTTGGCCACCAGGTCTCCTACCTGCCCCGGATGTGCCTCCAGTACCCATCCCTGTCCCCAGCCCAGCCCAGCTCAGATGAGGAGGAGGGCGAGCGGCAGAGCCCCCCACTGGAGGTGTCTGACGGCGAGGCGGATGGCCTGGAGCCCGGGCCTGGGCTCCTGCCTGGGGAGACAGGCAGCAAGAAGAAGATCCGCCTGTACCAGTTCCTGTTGGACCTGCTCCGCAGCGGCGACATGAAGGACAGCATCTGGTGGGTGGACAAGGACAAGGGCACCTTCCAGTTCTCGTCCAAGCACAAGGAGGCGCTGGCGCACCGCTGGGGCATCCAGAAGGGCAACCGCAAGAAGATGACCTACCAGAAGATGGCGCGCGCGCTGCGCAACTACGGCAAGACGGGCGAGGTCAAGAAGGTGAAGAAGAAGCTCACCTACCAGTTCAGCGGCGAAGTGCTGGGCCGCGGGGGCCTGGCCGAGCGGCGCCACCCGCCCCACTGA
ORF Protein Sequence MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1810-Ab Anti-SPI1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1810-Ag SPI1 protein
    ORF Viral Vector pGMLP003970 Human SPI1 Lentivirus plasmid
    ORF Viral Vector vGMLP003970 Human SPI1 Lentivirus particle


    Target information

    Target ID GM-IP1810
    Target Name SPI1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6688
    Gene ID 100051397 (Equus caballus), 101094951 (Felis catus), 20375 (Mus musculus), 366126 (Rattus norvegicus)
    507100 (Bos taurus), 611255 (Canis lupus familiaris), 6688 (Homo sapiens), 712010 (Macaca mulatta)
    Gene Symbols & Synonyms SPI1,Spi1,SPI1/PU.1,Dis1,PU.1,Dis-1,Sfpi1,Spi-1,Sfpi-1,Tcfpu1,Tfpu.1,Pu.1,OF,AGM10,SFPI1,SPI-1,SPI-A
    Target Alternative Names 31 kDa-transforming protein,AGM10,Dis-1,Dis1,OF,PU.1,Pu.1,SFPI1,SPI-1,SPI-A,SPI1,SPI1/PU.1,Sfpi-1,Sfpi1,Spi-1,Spi1,Tcfpu1,Tfpu.1,Transcription factor PU.1
    Uniprot Accession P17433,P17947,Q6BDS1
    Additional SwissProt Accessions: P17433,Q6BDS1,P17947
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease cancer
    Disease from KEGG Osteoclast differentiation, Human T-cell leukemia virus 1 infection, Pathways in cancer, Acute myeloid leukemia
    Gene Ensembl ENSECAG00000024457, ENSMUSG00000002111, ENSBTAG00000021709, ENSG00000066336, ENSMMUG00000015606
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.