Human TIMM22/TEX4/TIM22 ORF/cDNA clone-Lentivirus plasmid (NM_013337)

Cat. No.: pGMLP003961
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TIMM22/TEX4/TIM22 Lentiviral expression plasmid for TIMM22 lentivirus packaging, TIMM22 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TIM22/TIMM22/TIMM22/TEX4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $446.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003961
Gene Name TIMM22
Accession Number NM_013337
Gene ID 29928
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 585 bp
Gene Alias TEX4,TIM22
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGGCCGCCCCCAATGCCGGAGGCTCGGCCCCTGAGACAGCGGGTTCCGCCGAAGCTCCGCTGCAGTACAGCCTGCTCCTGCAGTACCTGGTGGGTGACAAGCGTCAGCCCCGGCTCCTGGAGCCTGGGAGCCTGGGCGGGATCCCAAGTCCAGCCAAGAGTGAGGAGCAGAAGATGATCGAGAAGGCGATGGAAAGCTGCGCTTTCAAGGCTGCGCTGGCCTGCGTGGGAGGATTTGTCTTAGGAGGTGCATTTGGGGTGTTTACCGCTGGCATCGATACCAACGTGGGCTTTGACCCTAAGGATCCTTACCGTACACCGACTGCAAAAGAAGTGCTGAAAGACATGGGGCAGAGAGGAATGTCCTATGCCAAAAATTTCGCCATTGTGGGAGCCATGTTTTCTTGTACTGAGTGTTTGATAGAATCTTACCGGGGAACATCAGACTGGAAGAACAGTGTCATCAGTGGCTGCATCACGGGAGGAGCTATTGGTTTCAGAGCTGGCTTAAAGGCTGGGGCCATTGGTTGTGGAGGTTTTGCTGCTTTCTCTGCTGCGATTGATTATTACCTCCGGTGA
ORF Protein Sequence MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1916-Ab Anti-TIMM22 monoclonal antibody
    Target Antigen GM-Tg-g-IP1916-Ag TIMM22 protein
    ORF Viral Vector pGMLP003961 Human TIMM22 Lentivirus plasmid
    ORF Viral Vector vGMLP003961 Human TIMM22 Lentivirus particle


    Target information

    Target ID GM-IP1916
    Target Name TIM22/TIMM22
    Gene Group Identifier
    (Target Gene ID in Homo species)
    29928
    Gene ID 100059837 (Equus caballus), 101089408 (Felis catus), 29928 (Homo sapiens), 480639 (Canis lupus familiaris)
    515555 (Bos taurus), 56322 (Mus musculus), 721162 (Macaca mulatta), 79463 (Rattus norvegicus)
    Gene Symbols & Synonyms TIMM22,Timm22,TEX4,TIM22,COXPD43,Tim22
    Target Alternative Names COXPD43,Mitochondrial import inner membrane translocase subunit Tim22,TEX4,TIM22,TIMM22,Testis-expressed protein 4,Tim22,Timm22
    Uniprot Accession Q5BIN4,Q9CQ85,Q9JKW1,Q9Y584
    Additional SwissProt Accessions: Q9Y584,Q5BIN4,Q9CQ85,Q9JKW1
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000023897, ENSG00000177370, ENSCAFG00845013556, ENSBTAG00000008423, ENSMUSG00000020843, ENSMMUG00000008129
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.