Human CD48/BLAST/BLAST1 ORF/cDNA clone-Lentivirus plasmid (BC016182)

Cat. No.: pGMLP003918
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD48/BLAST/BLAST1 Lentiviral expression plasmid for CD48 lentivirus packaging, CD48 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CD48/BLAST products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $483
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003918
Gene Name CD48
Accession Number BC016182
Gene ID 962
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 732 bp
Gene Alias BLAST,BLAST1,hCD48,mCD48,MEM-102,SLAMF2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGCTCCAGAGGTTGGGATTCGTGTCTGGCTCTGGAATTGCTACTGCTGCCTCTGTCACTCCTGGTGACCAGCATTCAAGGTCACTTGGTACATATGACCGTGGTCTCCGGCAGCAACGTGACTCTGAACATCTCTGAGAGCCTGCCTGAGAACTACAAACAACTAACCTGGTTTTATACTTTCGACCAGAAGATTGTAGAATGGGATTCCAGAAAATCTAAGTACTTTGAATCCAAATTTAAAGGCAGGGTCAGACTTGATCCTCAGAGTGGCGCACTGTACATCTCTAAGGTCCAGAAAGAGGACAACAGCACCTACATCATGAGGGTGTTGAAAAAGACTGGGAATGAGCAAGAATGGAAGATCAAGCTGCAAGTGCTTGACCCTGTACCCAAGCCTGTCATCAAAATTGAGAAGATAGAAGACATGGATGACAACTGTTATTTGAAACTGTCATGTGTGATACCTGGCGAGTCTGTAAACTACACCTGGTATGGGGACAAAAGGCCCTTCCCAAAGGAGCTCCAGAACAGTGTGCTTGAAACCACCCTTATGCCACATAATTACTCCAGGTGTTATACTTGCCAAGTCAGCAATTCTGTGAGCAGCAAGAATGGCACGGTCTGCCTCAGTCCACCCTGTACCCTGGCCCGGTCCTTTGGAGTAGAATGGATTGCAAGTTGGCTAGTGGTCACGGTGCCCACCATTCTTGGCCTGTTACTTACCTGA
ORF Protein Sequence MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0212-Ab Anti-CD48/ BCM1/ BLAST monoclonal antibody
    Target Antigen GM-Tg-g-MP0212-Ag CD48 VLP (virus-like particle)
    ORF Viral Vector pGMLP003283 Human CD48 Lentivirus plasmid
    ORF Viral Vector pGMLP003918 Human CD48 Lentivirus plasmid
    ORF Viral Vector vGMLP003283 Human CD48 Lentivirus particle
    ORF Viral Vector vGMLP003918 Human CD48 Lentivirus particle


    Target information

    Target ID GM-MP0212
    Target Name CD48
    Gene Group Identifier
    (Target Gene ID in Homo species)
    962
    Gene ID 100053868 (Equus caballus), 101089831 (Felis catus), 12506 (Mus musculus), 245962 (Rattus norvegicus)
    488642 (Canis lupus familiaris), 508386 (Bos taurus), 719762 (Macaca mulatta), 962 (Homo sapiens)
    Gene Symbols & Synonyms CD48,Cd48,BCM1,BLAST,Bcm-1,BLAST1,SLAMF2,Sgp-60,BLAST-1,MEM-102,hCD48,mCD48
    Target Alternative Names B-lymphocyte activation marker BLAST-1,BCM1,BCM1 surface antigen,BLAST,BLAST-1,BLAST1,Bcm-1,CD48,CD48 antigen,Cd48,Leukocyte antigen MEM-102,MEM-102,SLAM family member 2 (SLAMF2),SLAMF2,Sgp-60,Signaling lymphocytic activation molecule 2,TCT.1,hCD48,mCD48
    Uniprot Accession P09326,P10252,P18181
    Additional SwissProt Accessions: P18181,P10252,P09326
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG Natural killer cell mediated cytotoxicity
    Gene Ensembl ENSECAG00000013345, ENSMUSG00000015355, ENSCAFG00845030234, ENSBTAG00000011238, ENSMMUG00000015812, ENSG00000117091
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.