Human KCNK9/K2p9.1/KT3.2 ORF/cDNA clone-Lentivirus plasmid (NM_001282534)

Cat. No.: pGMLP003605
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KCNK9/K2p9.1/KT3.2 Lentiviral expression plasmid for KCNK9 lentivirus packaging, KCNK9 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to KCNK9/TASK3/KCNK9/K2p9.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $615
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003605
Gene Name KCNK9
Accession Number NM_001282534
Gene ID 51305
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1125 bp
Gene Alias K2p9.1,KT3.2,TASK-3,TASK3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGAGGCAGAACGTGCGGACTCTGTCCCTCATCGTCTGCACCTTCACCTACCTGCTGGTGGGCGCCGCCGTGTTCGACGCCCTCGAGTCGGACCACGAGATGCGCGAGGAGGAGAAACTCAAAGCCGAGGAGATCCGGATCAAGGGGAAGTACAACATCAGCAGCGAGGACTACCGGCAGCTGGAGCTGGTGATCCTGCAGTCGGAACCGCACCGCGCCGGCGTCCAGTGGAAATTCGCCGGCTCCTTCTACTTTGCGATCACGGTCATCACCACCATAGGTTATGGGCACGCTGCACCTGGCACCGATGCGGGCAAGGCCTTCTGCATGTTCTACGCCGTGCTGGGCATCCCGCTGACACTGGTCATGTTCCAGAGCCTGGGCGAGCGCATGAACACCTTCGTGCGCTACCTGCTGAAGCGCATTAAGAAGTGCTGTGGCATGCGCAACACTGACGTGTCTATGGAGAACATGGTGACTGTGGGCTTCTTCTCCTGCATGGGGACGCTGTGCATCGGGGCGGCCGCCTTCTCCCAGTGTGAGGAGTGGAGCTTCTTCCACGCCTACTACTACTGCTTCATCACGTTGACTACCATTGGGTTCGGGGACTACGTGGCCCTGCAGACCAAGGGTGCCCTGCAGAAGAAGCCGCTCTACGTGGCCTTTAGCTTTATGTATATCCTGGTGGGGCTGACGGTCATCGGGGCCTTCCTCAACCTGGTCGTCCTCAGGTTCTTGACCATGAACAGTGAGGATGAGCGGCGGGATGCTGAAGAGAGGGCATCCCTCGCCGGAAACCGCAACAGCATGGTCATTCACATCCCTGAGGAGCCGCGGCCCAGCCGGCCCAGGTACAAGGCGGACGTCCCGGACCTGCAGTCTGTGTGCTCCTGCACCTGCTACCGCTCGCAGGACTATGGCGGCCGCTCGGTGGCACCGCAGAACTCCTTCAGCGCCAAGCTTGCCCCCCACTACTTCCACTCCATCTCTTACAAGATCGAGGAGATCTCACCAAGCACATTAAAAAACAGCCTCTTCCCATCGCCTATTAGCTCCATCTCTCCTGGGTTACACAGCTTTACCGACCACCAGAGGCTGATGAAACGCCGGAAGTCCGTTTAG
ORF Protein Sequence MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T57613-Ab Anti-KCNK9/ TASK3/ K2p9.1 monoclonal antibody
    Target Antigen GM-Tg-g-T57613-Ag TASK3/KCNK9 VLP (virus-like particle)
    ORF Viral Vector pGMLP003605 Human KCNK9 Lentivirus plasmid
    ORF Viral Vector pGMLV000673 Human KCNK9 Lentivirus plasmid
    ORF Viral Vector vGMLP003605 Human KCNK9 Lentivirus particle
    ORF Viral Vector vGMLV000673 Human KCNK9 Lentivirus particle


    Target information

    Target ID GM-T57613
    Target Name KCNK9/TASK3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		51305
    Gene ID 100058202 (Equus caballus), 100425983 (Macaca mulatta), 101084682 (Felis catus), 223604 (Mus musculus)
    482057 (Canis lupus familiaris), 51305 (Homo sapiens), 539586 (Bos taurus), 84429 (Rattus norvegicus)
    Gene Symbols & Synonyms KCNK9,Kcnk9,Task3,A930009L07Rik,KT3.2,TASK3,BIBARS,K2p9.1,TASK-3,TASK32,Task-3
    Target Alternative Names A930009L07Rik,Acid-sensitive potassium channel protein TASK-3,BIBARS,K2p9.1,KCNK9,KT3.2,Kcnk9,Potassium channel subfamily K member 9,TASK-3,TASK3,TASK32,TWIK-related acid-sensitive K(+) channel 3,Task-3,Task3,Two pore potassium channel KT3.2 (Two pore K(+) channel KT3.2)
    Uniprot Accession Q3LS21,Q9ES08,Q9NPC2
    Additional SwissProt Accessions: Q3LS21,Q9NPC2,Q9ES08
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Aldosterone synthesis and secretion
    Gene Ensembl ENSMUSG00000036760, ENSG00000169427, ENSBTAG00000047488
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.