Human PAQR7/MPRA/mSR ORF/cDNA clone-Lentivirus plasmid (NM_178422)

Cat. No.: pGMLP003567
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PAQR7/MPRA/mSR Lentiviral expression plasmid for PAQR7 lentivirus packaging, PAQR7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PAQR7/MPRA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $591.48
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003567
Gene Name PAQR7
Accession Number NM_178422
Gene ID 164091
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1041 bp
Gene Alias MPRA,mSR,PGLP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCATGGCCCAGAAACTCAGCCACCTCCTGCCGAGTCTGCGGCAGGTCATCCAGGAGCCTCAGCTATCTCTGCAGCCAGAGCCTGTCTTCACGGTGGATCGAGCTGAGGTGCCGCCGCTCTTCTGGAAGCCGTACATCTATGCGGGCTACCGGCCGCTGCATCAGACCTGGCGCTTCTATTTCCGCACGCTGTTCCAGCAGCACAACGAGGCCGTGAATGTCTGGACCCACCTGCTGGCGGCCCTGGTACTGCTGCTGCGGCTGGCCCTCTTTGTGGAGACCGTGGACTTCTGGGGAGACCCACACGCCCTGCCCCTCTTCATCATTGTCCTTGCCTCTTTCACCTACCTCTCCTTCAGTGCCTTGGCTCACCTCCTGCAGGCCAAGTCTGAGTTCTGGCATTACAGCTTCTTCTTCCTGGACTATGTGGGGGTGGCCGTGTACCAGTTTGGCAGTGCCTTGGCACACTTCTACTATGCTATCGAGCCCGCCTGGCATGCCCAGGTGCAGGCTGTTTTTCTGCCCATGGCTGCCTTTCTCGCCTGGCTTTCCTGCATTGGCTCCTGCTATAACAAGTACATCCAGAAACCAGGCCTGCTGGGCCGCACATGCCAGGAGGTGCCCTCCGTCCTGGCCTACGCACTGGACATTAGTCCTGTGGTGCATCGTATCTTCGTGTCCTCCGACCCCACCACGGATGATCCAGCTCTTCTCTACCACAAGTGCCAGGTGGTCTTCTTTCTGCTGGCTGCTGCCTTCTTCTCTACCTTCATGCCCGAGCGCTGGTTCCCTGGCAGCTGCCATGTCTTCGGGCAGGGCCACCAACTTTTCCACATCTTCTTGGTGCTGTGCACGCTGGCTCAGCTGGAGGCTGTGGCACTGGACTATGAGGCCCGACGGCCCATCTATGAGCCTCTGCACACGCACTGGCCTCACAACTTTTCTGGCCTCTTCCTGCTCACGGTGGGCAGCAGCATCCTCACTGCATTCCTCCTGAGCCAGCTGGTACAGCGCAAACTTGATCAGAAGACCAAGTGA
ORF Protein Sequence MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1317-Ab Anti-PAQR7/ MPRA/ PGLP monoclonal antibody
    Target Antigen GM-Tg-g-MP1317-Ag PAQR7 VLP (virus-like particle)
    ORF Viral Vector pGMLP003567 Human PAQR7 Lentivirus plasmid
    ORF Viral Vector vGMLP003567 Human PAQR7 Lentivirus particle


    Target information

    Target ID GM-MP1317
    Target Name PAQR7
    Gene Group Identifier
    （Target Gene ID in Homo species)         		164091
    Gene ID 100071257 (Equus caballus), 101082327 (Felis catus), 164091 (Homo sapiens), 313615 (Rattus norvegicus)
    487364 (Canis lupus familiaris), 522932 (Bos taurus), 713411 (Macaca mulatta), 71904 (Mus musculus)
    Gene Symbols & Synonyms PAQR7,Paqr7,mSR,MPRA,PGLP,mPR,Mpra,mPR alpha,2310021M12Rik
    Target Alternative Names PAQR7,Membrane progestin receptor alpha,mPR alpha,Membrane progesterone P4 receptor alpha, Membrane progesterone receptor alpha, Progesterone and adipoQ receptor family member 7, Progestin and adipoQ receptor family member 7, Progestin and adipoQ receptor family member VII,mSR,MPRA,PGLP
    Uniprot Accession Q80ZE4,Q86WK9
    Additional SwissProt Accessions: Q86WK9,Q80ZE4
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Chemical carcinogenesis - receptor activation
    Gene Ensembl ENSECAG00000005649, ENSG00000182749, ENSBTAG00000021787, ENSMMUG00000007857, ENSMUSG00000037348
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.