Human HMOX1/bK286B10/HMOX1D ORF/cDNA clone-Lentivirus plasmid (NM_002133)

Cat. No.: pGMLP003511
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HMOX1/bK286B10/HMOX1D Lentiviral expression plasmid for HMOX1 lentivirus packaging, HMOX1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HO-1/HMOX1/HMOX1/bK286B10 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $516.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003511
Gene Name HMOX1
Accession Number NM_002133
Gene ID 3162
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 867 bp
Gene Alias bK286B10,HMOX1D,HO-1,HSP32
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCGTCCGCAACCCGACAGCATGCCCCAGGATTTGTCAGAGGCCCTGAAGGAGGCCACCAAGGAGGTGCACACCCAGGCAGAGAATGCTGAGTTCATGAGGAACTTTCAGAAGGGCCAGGTGACCCGAGACGGCTTCAAGCTGGTGATGGCCTCCCTGTACCACATCTATGTGGCCCTGGAGGAGGAGATTGAGCGCAACAAGGAGAGCCCAGTCTTCGCCCCTGTCTACTTCCCAGAAGAGCTGCACCGCAAGGCTGCCCTGGAGCAGGACCTGGCCTTCTGGTACGGGCCCCGCTGGCAGGAGGTCATCCCCTACACACCAGCCATGCAGCGCTATGTGAAGCGGCTCCACGAGGTGGGGCGCACAGAGCCCGAGCTGCTGGTGGCCCACGCCTACACCCGCTACCTGGGTGACCTGTCTGGGGGCCAGGTGCTCAAAAAGATTGCCCAGAAAGCCCTGGACCTGCCCAGCTCTGGCGAGGGCCTGGCCTTCTTCACCTTCCCCAACATTGCCAGTGCCACCAAGTTCAAGCAGCTCTACCGCTCCCGCATGAACTCCCTGGAGATGACTCCCGCAGTCAGGCAGAGGGTGATAGAAGAGGCCAAGACTGCGTTCCTGCTCAACATCCAGCTCTTTGAGGAGTTGCAGGAGCTGCTGACCCATGACACCAAGGACCAGAGCCCCTCACGGGCACCAGGGCTTCGCCAGCGGGCCAGCAACAAAGTGCAAGATTCTGCCCCCGTGGAGACTCCCAGAGGGAAGCCCCCACTCAACACCCGCTCCCAGGCTCCGCTTCTCCGATGGGTCCTTACACTCAGCTTTCTGGTGGCGACAGTTGCTGTAGGGCTTTATGCCATGTGA
ORF Protein Sequence MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0044-Ab Anti-HMOX1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0044-Ag HMOX1 protein
    ORF Viral Vector pGMLP003511 Human HMOX1 Lentivirus plasmid
    ORF Viral Vector pGMLV000302 Human HMOX1 Lentivirus plasmid
    ORF Viral Vector pGMLV000303 Human HMOX1 Lentivirus plasmid
    ORF Viral Vector pGMLV000774 Human HMOX1 Lentivirus plasmid
    ORF Viral Vector pGMLV002552 Human HMOX1 Lentivirus plasmid
    ORF Viral Vector pGMPC001181 Human HMOX1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001301 Human HMOX1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003511 Human HMOX1 Lentivirus particle
    ORF Viral Vector vGMLV000302 Human HMOX1 Lentivirus particle
    ORF Viral Vector vGMLV000303 Human HMOX1 Lentivirus particle
    ORF Viral Vector vGMLV000774 Human HMOX1 Lentivirus particle
    ORF Viral Vector vGMLV002552 Human HMOX1 Lentivirus particle


    Target information

    Target ID GM-IP0044
    Target Name HO-1/HMOX1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3162
    Gene ID 100069058 (Equus caballus), 101092621 (Felis catus), 15368 (Mus musculus), 24451 (Rattus norvegicus)
    3162 (Homo sapiens), 442987 (Canis lupus familiaris), 513221 (Bos taurus), 719266 (Macaca mulatta)
    Gene Symbols & Synonyms HMOX1,Hmox1,HO1,HO-1,Hmox,Hemox,Hsp32,D8Wsu38e,Ho1,Heox,Ho-1,HEOXG,hsp32,HSP32,HMOX1D,bK286B10
    Target Alternative Names D8Wsu38e,HEOXG,HMOX1,HMOX1D,HO-1,HO1,HSP32,Heme oxygenase 1,Hemox,Heox,Hmox,Hmox1,Ho-1,Ho1,Hsp32,bK286B10,hsp32
    Uniprot Accession P06762,P09601,P14901,Q5E9F2
    Additional SwissProt Accessions: P14901,P06762,P09601,Q5E9F2
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Acute kidney failure, Renal tubulo-interstitial diseases
    Disease from KEGG Metabolic pathways, HIF-1 signaling pathway, Ferroptosis, Mineral absorption, Pathways in cancer, Hepatocellular carcinoma, Fluid shear stress and atherosclerosis, Porphyrin metabolism
    Gene Ensembl ENSECAG00000001129, ENSMUSG00000005413, ENSG00000100292, ENSBTAG00000015582, ENSMMUG00000007221
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.