Human YWHAH/YWHA1 ORF/cDNA clone-Lentivirus plasmid (NM_003405)

Cat. No.: pGMLP003482
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human YWHAH/YWHA1 Lentiviral expression plasmid for YWHAH lentivirus packaging, YWHAH lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to YWHAH/YWHA1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $485.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003482
Gene Name YWHAH
Accession Number NM_003405
Gene ID 7533
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 741 bp
Gene Alias YWHA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGGACCGGGAGCAGCTGCTGCAGCGGGCGCGGCTGGCCGAGCAGGCGGAGCGCTACGACGACATGGCCTCCGCTATGAAGGCGGTGACAGAGCTGAATGAACCTCTCTCCAATGAAGATCGAAATCTCCTCTCTGTGGCCTACAAGAATGTGGTTGGTGCCAGGCGATCTTCCTGGAGGGTCATTAGCAGCATTGAGCAGAAAACCATGGCTGATGGAAACGAAAAGAAATTGGAGAAAGTTAAAGCTTACCGGGAGAAGATTGAGAAGGAGCTGGAGACAGTTTGCAATGATGTCCTGTCTCTGCTTGACAAGTTCCTGATCAAGAACTGCAATGATTTCCAGTATGAGAGCAAGGTGTTTTACCTGAAAATGAAGGGTGATTACTACCGCTACTTAGCAGAGGTCGCTTCTGGGGAGAAGAAAAACAGTGTGGTCGAAGCTTCTGAAGCTGCCTACAAGGAAGCCTTTGAAATCAGCAAAGAGCAGATGCAACCCACGCATCCCATCCGGCTGGGCCTGGCCCTCAACTTCTCCGTGTTCTACTATGAGATCCAGAATGCACCTGAGCAAGCCTGCCTCTTAGCCAAACAAGCCTTCGATGATGCCATAGCTGAGCTGGACACACTAAACGAGGATTCCTATAAGGACTCCACGCTGATCATGCAGTTGCTGCGAGACAACCTCACCCTCTGGACGAGCGACCAGCAGGATGAAGAAGCAGGAGAAGGCAACTGA
ORF Protein Sequence MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T52886-Ab Anti-YWHAH monoclonal antibody
    Target Antigen GM-Tg-g-T52886-Ag YWHAH protein
    ORF Viral Vector pGMLP003482 Human YWHAH Lentivirus plasmid
    ORF Viral Vector vGMLP003482 Human YWHAH Lentivirus particle


    Target information

    Target ID GM-T52886
    Target Name YWHAH
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7533
    Gene ID 100062878 (Equus caballus), 100687866 (Canis lupus familiaris), 101099908 (Felis catus), 22629 (Mus musculus)
    25576 (Rattus norvegicus), 282126 (Bos taurus), 717016 (Macaca mulatta), 7533 (Homo sapiens)
    Gene Symbols & Synonyms YWHAH,Ywhah,14-3-3e,YWHA1
    Target Alternative Names 14-3-3 protein eta,14-3-3e,Protein AS1,YWHA1,YWHAH,Ywhah
    Uniprot Accession P68509,P68510,P68511,Q04917
    Additional SwissProt Accessions: P68510,P68511,P68509,Q04917
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease lung cancer
    Disease from KEGG PI3K-Akt signaling pathway, Hippo signaling pathway, Hepatitis C
    Gene Ensembl ENSCAFG00845027045, ENSMUSG00000018965, ENSBTAG00000031134, ENSMMUG00000021727, ENSG00000128245
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.