Human TNFSF14/CD258/HVEML ORF/cDNA clone-Lentivirus plasmid (NM_003807)

Cat. No.: pGMLP003477
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TNFSF14/CD258/HVEML Lentiviral expression plasmid for TNFSF14 lentivirus packaging, TNFSF14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to LIGHT/CD258/TNFSF14/TNFSF14/CD258 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $480.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003477
Gene Name TNFSF14
Accession Number NM_003807
Gene ID 8740
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 723 bp
Gene Alias CD258,HVEML,LIGHT,LTg
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGAGAGTGTCGTACGGCCCTCAGTGTTTGTGGTGGATGGACAGACCGACATCCCATTCACGAGGCTGGGACGAAGCCACCGGAGACAGTCGTGCAGTGTGGCCCGGGTGGGTCTGGGTCTCTTGCTGTTGCTGATGGGGGCCGGGCTGGCCGTCCAAGGCTGGTTCCTCCTGCAGCTGCACTGGCGTCTAGGAGAGATGGTCACCCGCCTGCCTGACGGACCTGCAGGCTCCTGGGAGCAGCTGATACAAGAGCGAAGGTCTCACGAGGTCAACCCAGCAGCGCATCTCACAGGGGCCAACTCCAGCTTGACCGGCAGCGGGGGGCCGCTGTTATGGGAGACTCAGCTGGGCCTGGCCTTCCTGAGGGGCCTCAGCTACCACGATGGGGCCCTTGTGGTCACCAAAGCTGGCTACTACTACATCTACTCCAAGGTGCAGCTGGGCGGTGTGGGCTGCCCGCTGGGCCTGGCCAGCACCATCACCCACGGCCTCTACAAGCGCACACCCCGCTACCCCGAGGAGCTGGAGCTGTTGGTCAGCCAGCAGTCACCCTGCGGACGGGCCACCAGCAGCTCCCGGGTCTGGTGGGACAGCAGCTTCCTGGGTGGTGTGGTACACCTGGAGGCTGGGGAGAAGGTGGTCGTCCGTGTGCTGGATGAACGCCTGGTTCGACTGCGTGATGGTACCCGGTCTTACTTCGGGGCTTTCATGGTGTGA
ORF Protein Sequence MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-688 Pre-Made Quisovalimab biosimilar, Whole mAb, Anti-TNFSF14/CD258 Antibody: Anti-HVEML/LIGHT/LTg therapeutic antibody
    Target Antibody GM-Tg-g-MP1857-Ab Anti-TNF14/ TNFSF14/ CD258 monoclonal antibody
    Target Antigen GM-Tg-g-MP1857-Ag TNFSF14 VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-MP1857 Tumor necrosis factor superfamily member 14 (TNFSF14) protein & antibody
    ORF Viral Vector pGMLP003477 Human TNFSF14 Lentivirus plasmid
    ORF Viral Vector vGMLP003477 Human TNFSF14 Lentivirus particle


    Target information

    Target ID GM-MP1857
    Target Name LIGHT/CD258/TNFSF14
    Gene Group Identifier
    (Target Gene ID in Homo species)
    8740
    Gene ID 100060470 (Equus caballus), 101096542 (Felis catus), 301133 (Rattus norvegicus), 505521 (Bos taurus)
    50930 (Mus musculus), 611306 (Canis lupus familiaris), 701451 (Macaca mulatta), 8740 (Homo sapiens)
    Gene Symbols & Synonyms TNFSF14,Tnfsf14,TNLG1D,Tnlg1d,LTg,HVEML,LIGHT,Ly113,HVEM-L,CD258
    Target Alternative Names CD258,HVEM-L,HVEML,Herpes virus entry mediator ligand (HVEM-L,Herpesvirus entry mediator ligand),LIGHT,LTg,Ly113,TNFSF14,TNLG1D,Tnfsf14,Tnlg1d,Tumor necrosis factor ligand superfamily member 14
    Uniprot Accession O43557,Q9QYH9
    Additional SwissProt Accessions: Q9QYH9,O43557
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, NF-kappa B signaling pathway
    Gene Ensembl ENSECAG00000017522, ENSBTAG00000012223, ENSMUSG00000005824, ENSCAFG00845010429, ENSMMUG00000051945, ENSG00000125735
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.