Human TMEM215 ORF/cDNA clone-Lentivirus plasmid (NM_212558)
Cat. No.: pGMLP003472
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TMEM215/ Lentiviral expression plasmid for TMEM215 lentivirus packaging, TMEM215 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TMEM215 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP003472 |
| Gene Name | TMEM215 |
| Accession Number | NM_212558 |
| Gene ID | 401498 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 708 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCGGCCTGATGACATTAACCCGAGGACTGGGCTGGTGGTGGCCCTGGTCAGTGTCTTCCTCGTCTTTGGTTTCATGTTCACCGTCTCTGGGATGAAAGGGGAGACTTTGGGAAACATCCCCCTCCTGGCCATCGGGCCAGCCATCTGCCTACCAGGCATCGCAGCCATTGCCCTGGCCAGGAAAACCGAGGGATGCACCAAGTGGCCAGAGAACGAGCTGCTGTGGGTCCGCAAATTGCCCTGCTTCCGGAAACCCAAAGACAAGGAGGTGGTAGAGCTGCTGAGGACCCCTTCAGACCTAGAATCCGGCAAGGGGAGCTCAGATGAGCTGGCTAAGAAGGCGGGCCTCAGGGGGAAGCCTCCCCCACAAAGCCAGGGTGAGGTGTCCGTGGCCAGCTCCATCAACAGCCCCACACCCACGGAGGAAGGAGAATGCCAGAGCCTCGTCCAGAATGGGCATCAGGAGGAGACGTCCAGATACCTGGACGGCTACTGCCCCTCGGGCAGTTCCCTCACCTACAGTGCCTTGGACGTCAAGTGCTCAGCAAGGGACAGATCTGAGTGCCCTGAGCCTGAGGATAGCATCTTCTTTGTGCCCCAGGACAGTATCATCGTTTGCTCCTACAAGCAGAACAGCCCGTATGACAGATACTGTTGTTATATCAATCAGATACAAGGCAGGTGGGACCACGAGACCATCGTCTAA |
| ORF Protein Sequence | MRPDDINPRTGLVVALVSVFLVFGFMFTVSGMKGETLGNIPLLAIGPAICLPGIAAIALARKTEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGEVSVASSINSPTPTEEGECQSLVQNGHQEETSRYLDGYCPSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYKQNSPYDRYCCYINQIQGRWDHETIV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP2049-Ab | Anti-TMEM215 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP2049-Ag | TMEM215 protein |
| ORF Viral Vector | pGMLP003472 | Human TMEM215 Lentivirus plasmid |
| ORF Viral Vector | pGMAD000411 | Human TMEM215 Adenovirus plasmid |
| ORF Viral Vector | pGMAD000723 | Human TMEM215 Adenovirus plasmid |
| ORF Viral Vector | vGMLP003472 | Human TMEM215 Lentivirus particle |
| ORF Viral Vector | vGMAD000411 | Human TMEM215 Adenovirus particle |
| ORF Viral Vector | vGMAD000723 | Human TMEM215 Adenovirus particle |
Target information
| Target ID | GM-IP2049 |
| Target Name | TMEM215 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
401498 |
| Gene ID |
100053699 (Equus caballus), 101097185 (Felis catus), 320500 (Mus musculus), 401498 (Homo sapiens) 510133 (Bos taurus), 611763 (Canis lupus familiaris), 690918 (Rattus norvegicus), 704427 (Macaca mulatta) |
| Gene Symbols & Synonyms | TMEM215,Tmem215,A930001M12Rik |
| Target Alternative Names | A930001M12Rik,TMEM215,Tmem215,Transmembrane protein 215 |
| Uniprot Accession |
A7E1Z1,A7MB05,Q68D42
Additional SwissProt Accessions: A7E1Z1,Q68D42,A7MB05 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | |
| Disease | |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000004732, ENSMUSG00000046593, ENSG00000188133, ENSBTAG00000013974, ENSCAFG00845019629, ENSMMUG00000053668 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


