Human ESM1/endocan ORF/cDNA clone-Lentivirus plasmid (NM_007036)

Cat. No.: pGMLP003427
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ESM1/endocan Lentiviral expression plasmid for ESM1 lentivirus packaging, ESM1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ESM1/endocan products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $438.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003427
Gene Name ESM1
Accession Number NM_007036
Gene ID 11082
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 555 bp
Gene Alias endocan
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGAGCGTCTTGCTGCTGACCACGCTCCTCGTGCCTGCACACCTGGTGGCCGCCTGGAGCAATAATTATGCGGTGGACTGCCCTCAACACTGTGACAGCAGTGAGTGCAAAAGCAGCCCGCGCTGCAAGAGGACAGTGCTCGACGACTGTGGCTGCTGCCGAGTGTGCGCTGCAGGGCGGGGAGAAACTTGCTACCGCACAGTCTCAGGCATGGATGGCATGAAGTGTGGCCCGGGGCTGAGGTGTCAGCCTTCTAATGGGGAGGATCCTTTTGGTGAAGAGTTTGGTATCTGCAAAGACTGTCCCTACGGCACCTTCGGGATGGATTGCAGAGAGACCTGCAACTGCCAGTCAGGCATCTGTGACAGGGGGACGGGAAAATGCCTGAAATTCCCCTTCTTCCAATATTCAGTAACCAAGTCTTCCAACAGATTTGTTTCTCTCACGGAGCATGACATGGCATCTGGAGATGGCAATATTGTGAGAGAAGAAGTTGTGAAAGAGAATGCTGCCGGGTCTCCCGTAATGAGGAAATGGTTAAATCCACGCTGA
ORF Protein Sequence MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0909-Ab Anti-ESM1/ endocan functional antibody
    Target Antigen GM-Tg-g-SE0909-Ag ESM1 protein
    Cytokine cks-Tg-g-GM-SE0909 endothelial cell-specific molecule 1 (ESM1) protein & antibody
    ORF Viral Vector pGMLP003427 Human ESM1 Lentivirus plasmid
    ORF Viral Vector pGMPC004897 Human ESM1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003427 Human ESM1 Lentivirus particle


    Target information

    Target ID GM-SE0909
    Target Name ESM1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		11082
    Gene ID 100052185 (Equus caballus), 101088303 (Felis catus), 11082 (Homo sapiens), 489201 (Canis lupus familiaris)
    539571 (Bos taurus), 64536 (Rattus norvegicus), 705229 (Macaca mulatta), 71690 (Mus musculus)
    Gene Symbols & Synonyms ESM1,Esm1,endocan,Pg25,ESM-1,0610042H23Rik
    Target Alternative Names 0610042H23Rik,ESM-1,ESM1,Endothelial cell-specific molecule 1,Esm1,Pg25,endocan
    Uniprot Accession P97682,Q9NQ30,Q9QYY7
    Additional SwissProt Accessions: Q9NQ30,P97682,Q9QYY7
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Breast Cancer, Ovary Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000013106, ENSG00000164283, ENSCAFG00845011480, ENSBTAG00000004221, ENSMMUG00000020169, ENSMUSG00000042379
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.