Human GREM2/CKTSF1B2/DAND3 ORF/cDNA clone-Lentivirus plasmid (NM_022469)

Cat. No.: pGMLP003417
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GREM2/CKTSF1B2/DAND3 Lentiviral expression plasmid for GREM2 lentivirus packaging, GREM2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GREM2/CKTSF1B2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $426.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003417
Gene Name GREM2
Accession Number NM_022469
Gene ID 64388
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 507 bp
Gene Alias CKTSF1B2,DAND3,PRDC,STHAG9
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTCTGGAAGCTTTCCCTGTCCTTGTTCCTGGTGGCGGTGCTGGTGAAGGTGGCGGAAGCCCGGAAGAACCGGCCGGCGGGCGCCATCCCCTCGCCTTACAAGGACGGCAGCAGCAACAACTCGGAGAGATGGCAGCACCAGATCAAGGAGGTGCTGGCCTCCAGCCAGGAGGCCCTGGTGGTCACCGAGCGCAAGTACCTCAAGAGTGACTGGTGCAAGACGCAGCCGCTGCGGCAGACGGTGAGCGAGGAGGGCTGCCGGAGCCGCACCATCCTCAACCGCTTCTGCTACGGCCAGTGCAACTCCTTCTACATCCCGCGGCACGTGAAGAAGGAGGAGGAGTCCTTCCAGTCCTGCGCCTTCTGCAAGCCCCAGCGCGTCACCTCCGTCCTCGTGGAGCTCGAGTGCCCCGGCCTGGACCCACCCTTCCGACTCAAGAAAATCCAGAAGGTGAAGCAGTGCCGGTGCATGTCCGTGAACCTGAGCGACTCGGACAAGCAGTGA
ORF Protein Sequence MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0959-Ab Anti-GREM2/ CKTSF1B2/ DAND3 functional antibody
    Target Antigen GM-Tg-g-SE0959-Ag GREM2 protein
    ORF Viral Vector pGMLP003417 Human GREM2 Lentivirus plasmid
    ORF Viral Vector vGMLP003417 Human GREM2 Lentivirus particle


    Target information

    Target ID GM-SE0959
    Target Name GREM2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    64388
    Gene ID 100060243 (Equus caballus), 101096531 (Felis catus), 23893 (Mus musculus), 289264 (Rattus norvegicus)
    490367 (Canis lupus familiaris), 64388 (Homo sapiens), 708280 (Macaca mulatta)
    Gene Symbols & Synonyms GREM2,Grem2,Prdc,Gremlin2,RGD1560008,PRDC,DAND3,STHAG9,CKTSF1B2
    Target Alternative Names BMP antagonist 2,CKTSF1B2,Cysteine knot superfamily 1,DAN domain family member 3,DAND3,GREM2,Grem2,Gremlin-2,Gremlin2,PRDC,Prdc,Protein related to DAN and cerberus,RGD1560008,STHAG9
    Uniprot Accession O88273,Q9H772
    Additional SwissProt Accessions: O88273,Q9H772
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG TGF-beta signaling pathway
    Gene Ensembl ENSECAG00000003167, ENSMUSG00000050069, ENSCAFG00845004033, ENSG00000180875, ENSMMUG00000064824
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.