Human FAM96A/CIA2A ORF/cDNA clone-Lentivirus plasmid (NM_032231)

Cat. No.: pGMLP003413
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FAM96A/CIA2A Lentiviral expression plasmid for FAM96A lentivirus packaging, FAM96A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FAM96A/CIAO2A/FAM96A/CIA2A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003413
Gene Name FAM96A
Accession Number NM_032231
Gene ID 84191
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 483 bp
Gene Alias CIA2A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCGGGTGTCCGGGCTGCTCTCCTGGACGCTGAGCAGAGTCCTGTGGCTCTCCGGCCTCTCTGAGCCGGGAGCTGCCCGGCAGCCCCGGATCATGGAAGAGAAAGCGCTAGAAGTTTATGATTTGATTAGAACTATCCGGGACCCAGAAAAGCCCAATACTTTAGAAGAACTGGAAGTGGTCTCGGAAAGTTGTGTGGAAGTTCAGGAGATAAATGAAGAAGAATATCTGGTTATTATCAGGTTCACGCCAACAGTACCTCATTGCTCTTTGGCGACTCTTATTGGGCTGTGCTTAAGAGTAAAACTTCAGCGATGTTTACCATTTAAACATAAGTTGGAAATCTACATTTCTGAAGGAACCCACTCAACAGAAGAAGACATCAATAAGCAGATAAATGACAAAGAGCGAGTGGCAGCTGCAATGGAAAACCCCAACTTACGGGAAATTGTGGAACAGTGTGTCCTTGAACCTGACTGA
ORF Protein Sequence MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1575-Ab Anti-CIA2A/ CIAO2A/ FAM96A functional antibody
    Target Antigen GM-Tg-g-SE1575-Ag CIAO2A protein
    ORF Viral Vector pGMLP003413 Human FAM96A Lentivirus plasmid
    ORF Viral Vector vGMLP003413 Human FAM96A Lentivirus particle


    Target information

    Target ID GM-SE1575
    Target Name FAM96A/CIAO2A
    Gene Group Identifier
    （Target Gene ID in Homo species)         		84191
    Gene ID 100053881 (Equus caballus), 101089269 (Felis catus), 300797 (Rattus norvegicus), 478335 (Canis lupus familiaris)
    512871 (Bos taurus), 68250 (Mus musculus), 712029 (Macaca mulatta), 84191 (Homo sapiens)
    Gene Symbols & Synonyms CIAO2A,Ciao2a,FAM96A,Fam96a,RGD1307481,5730536A07Rik,CIA2A
    Target Alternative Names FAM96A, CIAO2A,Cytosolic iron-sulfur assembly component 2A,MIP18 family protein FAM96A,CIA2A,FAM96A
    Uniprot Accession Q3T0U7,Q9DCL2,Q9H5X1
    Additional SwissProt Accessions: Q3T0U7,Q9DCL2,Q9H5X1
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000010303, ENSCAFG00845022079, ENSBTAG00000002012, ENSMUSG00000032381, ENSMMUG00000014004, ENSG00000166797
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.