Human IER3/DIF-2/DIF2 ORF/cDNA clone-Lentivirus plasmid (NM_003897)

Cat. No.: pGMLP003411
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IER3/DIF-2/DIF2 Lentiviral expression plasmid for IER3 lentivirus packaging, IER3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IER3/DIF-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003411
Gene Name IER3
Accession Number NM_003897
Gene ID 8870
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 471 bp
Gene Alias DIF-2,DIF2,GLY96,IEX-1,IEX-1L,IEX1,PRG1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGTCACTCTCGCAGCTGCCACCCGACCATGACCATCCTGCAGGCCCCGACCCCGGCCCCCTCCACCATCCCGGGACCCCGGCGGGGCTCCGGTCCTGAGATCTTCACCTTCGACCCTCTCCCGGAGCCCGCAGCGGCCCCTGCCGGGCGCCCCAGCGCCTCTCGCGGGCACCGAAAGCGCAGCCGCAGGGTTCTCTACCCTCGAGTGGTCCGGCGCCAGCTGCCAGTCGAGGAACCGAACCCAGCCAAAAGGCTTCTCTTTCTGCTGCTCACCATCGTCTTCTGCCAGATCCTGATGGCTGAAGAGGGTGTGCCGGCGCCCCTGCCTCCAGAGGACGCCCCTAACGCCGCATCCCTGGCGCCCACCCCTGTGTCCGCCGTCCTCGAGCCCTTTAATCTGACTTCGGAGCCCTCGGACTACGCTCTGGACCTCAGCACTTTCCTCCAGCAACACCCGGCCGCCTTCTAA
ORF Protein Sequence MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0995-Ab Anti-IER3 monoclonal antibody
    Target Antigen GM-Tg-g-IP0995-Ag IER3 protein
    ORF Viral Vector pGMLP003411 Human IER3 Lentivirus plasmid
    ORF Viral Vector vGMLP003411 Human IER3 Lentivirus particle


    Target information

    Target ID GM-IP0995
    Target Name IER3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    8870
    Gene ID 100055430 (Equus caballus), 101096476 (Felis catus), 15937 (Mus musculus), 294235 (Rattus norvegicus)
    481708 (Canis lupus familiaris), 505455 (Bos taurus), 701939 (Macaca mulatta), 8870 (Homo sapiens)
    Gene Symbols & Synonyms IER3,Ier3,cI-3,IEX-1,gly96,Dif2,Iex1,Ler3,Prg1,DIF2,IEX1,PRG1,DIF-2,GLY96,IEX-1L
    Target Alternative Names DIF-2,DIF2,Dif2,Differentiation-dependent gene 2 protein (Protein DIF-2),GLY96,IER3,IEX-1,IEX-1L,IEX1,Ier3,Iex1,Immediate early protein GLY96,Immediate early response 3 protein,Ler3,PACAP-responsive gene 1 protein (Protein PRG1),PRG1,Prg1,Radiation-inducible immediate-early gene IEX-1,cI-3,gly96
    Uniprot Accession P46694,P46695
    Additional SwissProt Accessions: P46694,P46695
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000017157, ENSMUSG00000003541, ENSCAFG00845008177, ENSMMUG00000064297, ENSG00000137331
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.