Human SAA1/PIG4/SAA ORF/cDNA clone-Lentivirus plasmid (NM_000331)

Cat. No.: pGMLP003395
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SAA1/PIG4/SAA Lentiviral expression plasmid for SAA1 lentivirus packaging, SAA1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SAA1/PIG4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003395
Gene Name SAA1
Accession Number NM_000331
Gene ID 6288
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 369 bp
Gene Alias PIG4,SAA,SAA2,TP53I4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCTTCTCACGGGCCTGGTTTTCTGCTCCTTGGTCCTGGGTGTCAGCAGCCGAAGCTTCTTTTCGTTCCTTGGCGAGGCTTTTGATGGGGCTCGGGACATGTGGAGAGCCTACTCTGACATGAGAGAAGCCAATTACATCGGCTCAGACAAATACTTCCATGCTCGGGGGAACTATGATGCTGCCAAAAGGGGACCTGGGGGTGCCTGGGCTGCAGAAGTGATCACCGATGCCAGAGAGAATATCCAGAGATTCTTTGGCCATGGTGCGGAGGACTCGCTGGCTGATCAGGCTGCCAATGAATGGGGCAGGAGTGGCAAAGACCCCAATCACTTCCGACCTGCTGGCCTGCCTGAGAAATACTGA
ORF Protein Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-654 Pre-Made Anselamimab biosimilar, Whole mAb, Anti-SAA1 Antibody: Anti-PIG4/SAA/SAA2/TP53I4 therapeutic antibody
    Biosimilar GMP-Bios-ab-072 Pre-Made Birtamimab biosimilar, Whole mAb, Anti-SAA1 Antibody: Anti-PIG4/SAA/SAA2/TP53I4 therapeutic antibody
    Target Antibody GM-Tg-g-T55447-Ab Anti-SAA1/ PIG4/ SAA functional antibody
    Target Antigen GM-Tg-g-T55447-Ag SAA1 protein
    ORF Viral Vector pGMLP003395 Human SAA1 Lentivirus plasmid
    ORF Viral Vector pGMLV002410 Human SAA1 Lentivirus plasmid
    ORF Viral Vector pGMLV002502 Human SAA1 Lentivirus plasmid
    ORF Viral Vector pGMLV002619 Human SAA1 Lentivirus plasmid
    ORF Viral Vector vGMLP003395 Human SAA1 Lentivirus particle
    ORF Viral Vector vGMLV002410 Human SAA1 Lentivirus particle
    ORF Viral Vector vGMLV002502 Human SAA1 Lentivirus particle
    ORF Viral Vector vGMLV002619 Human SAA1 Lentivirus particle


    Target information

    Target ID GM-T55447
    Target Name SAA1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6288
    Gene ID 119865027 (Canis lupus familiaris), 6288 (Homo sapiens), 694944 (Macaca mulatta)
    Gene Symbols & Synonyms SAA1,SAA,PIG4,SAA2,TP53I4
    Target Alternative Names PIG4,SAA,SAA1,SAA2,Serum amyloid A-1 protein,TP53I4
    Uniprot Accession P02738,P0DJI8
    Additional SwissProt Accessions: P0DJI8,P02738
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker, INN Index
    Disease
    Disease from KEGG
    Gene Ensembl ENSCAFG00845015612, ENSG00000173432, ENSMMUG00000060306
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.