Human CCL15/HCC-2/HMRP-2B ORF/cDNA clone-Lentivirus plasmid (NM_032965)

Cat. No.: pGMLP003385
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL15/HCC-2/HMRP-2B Lentiviral expression plasmid for CCL15 lentivirus packaging, CCL15 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCL15/HCC-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003385
Gene Name CCL15
Accession Number NM_032965
Gene ID 6359
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 342 bp
Gene Alias HCC-2,HMRP-2B,LKN-1,LKN1,MIP-1 delta,MIP-1D,MIP-5,MRP-2B,NCC-3,NCC3,SCYA15,SCYL3,SY15
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGTCTCCGTGGCTGCCCTCTCCTGCCTCATGCTTGTTGCTGTCCTTGGATCCCAGGCCCAGTTCACAAATGATGCAGAGACAGAGTTAATGATGTCAAAGCTTCCACTGGAAAATCCAGTAGTTCTGAACAGCTTTCACTTTGCTGCTGACTGCTGCACCTCCTACATCTCACAAAGCATCCCGTGTTCACTCATGAAAAGTTATTTTGAAACGAGCAGCGAGTGCTCCAAGCCAGGTGTCATATTCCTCACCAAGAAGGGGCGGCAAGTCTGTGCCAAACCCAGTGGTCCGGGAGTTCAGGATTGCATGAAAAAGCTGAAGCCCTACTCAATATAA
ORF Protein Sequence MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0069-Ab Anti-CCL15/ HCC-2/ HMRP-2B functional antibody
    Target Antigen GM-Tg-g-SE0069-Ag CCL15 protein
    Cytokine cks-Tg-g-GM-SE0069 chemokine (C-C motif) ligand 15 (CCL15) protein & antibody
    ORF Viral Vector pGMLP003385 Human CCL15 Lentivirus plasmid
    ORF Viral Vector vGMLP003385 Human CCL15 Lentivirus particle


    Target information

    Target ID GM-SE0069
    Target Name CCL15
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6359
    Gene ID 100071540 (Equus caballus), 100430368 (Macaca mulatta), 6359 (Homo sapiens)
    Gene Symbols & Synonyms CCL15,LKN1,NCC3,SY15,HCC-2,LKN-1,MIP-5,NCC-3,SCYL3,MIP-1D,MRP-2B,SCYA15,HMRP-2B,MIP-1 delta
    Target Alternative Names CCL15,C-C motif chemokine 15,Chemokine CC-2 (HCC-2), Leukotactin-1 (LKN-1), MIP-1 delta, Macrophage inflammatory protein 5 (MIP-5), Mrp-2b, NCC-3, Small-inducible cytokine A15,LKN1,NCC3,SY15,HCC-2,LKN-1,MIP-5,NCC-3,SCYL3,MIP-1D,MRP-2B,SCYA15,HMRP-2B,MIP-1 delta
    Uniprot Accession Q16663
    Additional SwissProt Accessions: Q16663
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Lung Cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway
    Gene Ensembl ENSMMUG00000039864, ENSG00000275718
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.