Human APOC2/APO-CII/APOC-II ORF/cDNA clone-Lentivirus plasmid (NM_000483)

Cat. No.: pGMLP003380
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human APOC2/APO-CII/APOC-II Lentiviral expression plasmid for APOC2 lentivirus packaging, APOC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to APOC2/APO-CII products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003380
Gene Name APOC2
Accession Number NM_000483
Gene ID 344
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 306 bp
Gene Alias APO-CII,APOC-II
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCACACGACTCCTCCCAGCTCTGTTTCTTGTCCTCCTGGTATTGGGATTTGAGGTCCAGGGGACCCAACAGCCCCAGCAAGATGAGATGCCTAGCCCGACCTTCCTCACCCAGGTGAAGGAATCTCTCTCCAGTTACTGGGAGTCAGCAAAGACAGCCGCCCAGAACCTGTACGAGAAGACATACCTGCCCGCTGTAGATGAGAAACTCAGGGACTTGTACAGCAAAAGCACAGCAGCCATGAGCACTTACACAGGCATTTTTACTGACCAAGTTCTTTCTGTGCTGAAGGGAGAGGAGTAA
ORF Protein Sequence MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0673-Ab Anti-APOC2/ APO-CII/ APOC-II functional antibody
    Target Antigen GM-Tg-g-SE0673-Ag APOC2 protein
    ORF Viral Vector pGMLP003380 Human APOC2 Lentivirus plasmid
    ORF Viral Vector pGMLP004009 Human APOC2 Lentivirus plasmid
    ORF Viral Vector vGMLP003380 Human APOC2 Lentivirus particle
    ORF Viral Vector vGMLP004009 Human APOC2 Lentivirus particle


    Target information

    Target ID GM-SE0673
    Target Name APOC2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    344
    Gene ID 100065532 (Equus caballus), 100499578 (Macaca mulatta), 101096861 (Felis catus), 11813 (Mus musculus)
    292697 (Rattus norvegicus), 344 (Homo sapiens), 442969 (Canis lupus familiaris), 618039 (Bos taurus)
    Gene Symbols & Synonyms APOC2,Apoc2,APOC4,apo-CII,apoC-II,Apo-CII,ApoC-II,RGD1560725,APO-CII,APOC-II,APOCII
    Target Alternative Names APOC2,Apolipoprotein C-II,Apo-CII, ApoC-II,Apolipoprotein C2,APO-CII,APOC-II
    Uniprot Accession G3V8D4,P02655,P12278,P19034,Q05020
    Additional SwissProt Accessions: Q05020,G3V8D4,P02655,P12278,P19034
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease Malignant neoplasm of bladder
    Disease from KEGG Cholesterol metabolism
    Gene Ensembl ENSMMUG00000055305, ENSMUSG00000002992, ENSG00000234906, ENSCAFG00845006579, ENSBTAG00000020558
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.