Human IGF1/IGF-I/IGFI ORF/cDNA clone-Lentivirus plasmid (NM_001111283)
Cat. No.: pGMLP003306
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IGF1/IGF-I/IGFI Lentiviral expression plasmid for IGF1 lentivirus packaging, IGF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IGF1/IGF-I products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP003306 |
| Gene Name | IGF1 |
| Accession Number | NM_001111283 |
| Gene ID | 3479 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 477 bp |
| Gene Alias | IGF-I,IGFI,MGF |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGAAAAATCAGCAGTCTTCCAACCCAATTATTTAAGTGCTGCTTTTGTGATTTCTTGAAGGTGAAGATGCACACCATGTCCTCCTCGCATCTCTTCTACCTGGCGCTGTGCCTGCTCACCTTCACCAGCTCTGCCACGGCTGGACCGGAGACGCTCTGCGGGGCTGAGCTGGTGGATGCTCTTCAGTTCGTGTGTGGAGACAGGGGCTTTTATTTCAACAAGCCCACAGGGTATGGCTCCAGCAGTCGGAGGGCGCCTCAGACAGGCATCGTGGATGAGTGCTGCTTCCGGAGCTGTGATCTAAGGAGGCTGGAGATGTATTGCGCACCCCTCAAGCCTGCCAAGTCAGCTCGCTCTGTCCGTGCCCAGCGCCACACCGACATGCCCAAGACCCAGAAGTATCAGCCCCCATCTACCAACAAGAACACGAAGTCTCAGAGAAGGAAAGGAAGTACATTTGAAGAACGCAAGTAG |
| ORF Protein Sequence | MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEERK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T60930 |
| Target Name | IGF1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3479 |
| Gene ID |
100034198 (Equus caballus), 101101237 (Felis catus), 16000 (Mus musculus), 24482 (Rattus norvegicus) 281239 (Bos taurus), 3479 (Homo sapiens), 610255 (Canis lupus familiaris), 698444 (Macaca mulatta) |
| Gene Symbols & Synonyms | IGF1,Igf1,Igf-1,Igf-I,C730016P09Rik,IGF,IGF-1,IGF-I,MGF,IGFI,IGFIA |
| Target Alternative Names | C730016P09Rik,IGF,IGF-1,IGF-I,IGF1,IGFI,IGFIA,Igf-1,Igf-I,Igf1,Insulin-like growth factor 1,Insulin-like growth factor I (IGF-I),MGF,Mechano growth factor (MGF),Somatomedin-C |
| Uniprot Accession |
P05017,P05019,P07455,P08025,P33712,P51458
Additional SwissProt Accessions: P51458,P05017,P08025,P07455,P05019,P33712 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, INN Index, Cytokine Target |
| Disease | cancer, Prostate Cancer |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, HIF-1 signaling pathway, FoxO signaling pathway, p53 signaling pathway, PI3K-Akt signaling pathway, Longevity regulating pathway, Longevity regulating pathway - multiple species, Focal adhesion, Signaling pathways regulating pluripotency of stem cells, Inflammatory mediator regulation of TRP channels, Ovarian steroidogenesis, Growth hormone synthesis, secretion and action, Aldosterone-regulated sodium reabsorption, Pathways in cancer, Proteoglycans in cancer, Glioma, Prostate cancer, Melanoma, Breast cancer, Hypertrophic cardiomyopathy, Dilated cardiomyopathy |
| Gene Ensembl | ENSECAG00000010109, ENSMUSG00000020053, ENSBTAG00000011082, ENSG00000017427, ENSCAFG00845009366, ENSMMUG00000002235 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


