Human SRD5A1/S5AR 1 ORF/cDNA clone-Lentivirus plasmid (NM_001324323)

Cat. No.: pGMLP003302
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SRD5A1/S5AR 1 Lentiviral expression plasmid for SRD5A1 lentivirus packaging, SRD5A1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SRD5A1/S5AR 1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $440.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003302
Gene Name SRD5A1
Accession Number NM_001324323
Gene ID 6715
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 561 bp
Gene Alias S5AR 1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTTTACCCTGGCGCACATGGTCAGAATGGAAACAAATAACAAGCTTTACAGTTTTTCCTGCTCTATTAAGGTGCTTAATTTACCCATTTCTGATGCGAGGAGGAAAGCCTATGCCACTGTTGGCGTGTACAATGGCGATTATGTTCTGTACCTGTAACGGCTATTTGCAAAGCAGATACTTGAGCCATTGTGCAGTGTATGCTGATGACTGGGTAACAGATCCCCGTTTTCTAATAGGTTTTGGCTTGTGGTTAACGGGCATGTTGATAAACATCCATTCAGATCATATCCTAAGGAATCTCAGAAAACCAGGAGATACTGGATACAAAATACCAAGGGGAGGCTTATTTGAATACGTAACTGCAGCCAACTATTTTGGAGAAATCATGGAGTGGTGTGGCTATGCCCTGGCCAGCTGGTCTGTCCAAGGCGCGGCTTTTGCTTTCTTCACGTTTTGTTTTTTATCTGGTAGAGCAAAAGAGCATCATGAGTGGTACCTCCGGAAATTTGAAGAGTATCCAAAGTTCAGAAAAATTATAATTCCATTTTTGTTTTAA
ORF Protein Sequence MTLPWRTWSEWKQITSFTVFPALLRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0056-Ab Anti-SRD5A1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0056-Ag SRD5A1 protein
    ORF Viral Vector pGMLP003302 Human SRD5A1 Lentivirus plasmid
    ORF Viral Vector pGMLP004030 Human SRD5A1 Lentivirus plasmid
    ORF Viral Vector vGMLP003302 Human SRD5A1 Lentivirus particle
    ORF Viral Vector vGMLP004030 Human SRD5A1 Lentivirus particle


    Target information

    Target ID GM-IP0056
    Target Name SRD5A1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6715
    Gene ID 100071450 (Equus caballus), 101098848 (Felis catus), 24950 (Rattus norvegicus), 403716 (Canis lupus familiaris)
    614612 (Bos taurus), 6715 (Homo sapiens), 695103 (Macaca mulatta), 78925 (Mus musculus)
    Gene Symbols & Synonyms SRD5A1,Srd5a1,S5AR 1,Srd5a-1,0610031P22Rik,4930435F02Rik
    Target Alternative Names SRD5A1,3-oxo-5-alpha-steroid 4-dehydrogenase 1,SR type 1, Steroid 5-alpha-reductase 1 (S5AR 1),S5AR 1
    Uniprot Accession A5PJS2,P18405,P24008,Q68FF9
    Additional SwissProt Accessions: P24008,A5PJS2,P18405,Q68FF9
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Metabolic pathways, Steroid hormone biosynthesis
    Gene Ensembl ENSECAG00000012520, ENSCAFG00845023819, ENSBTAG00000015478, ENSG00000145545, ENSMMUG00000013186, ENSMUSG00000021594
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.