Human RNF5/RING5/RMA1 ORF/cDNA clone-Lentivirus plasmid (NM_006913)

Cat. No.: pGMLP003006
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RNF5/RING5/RMA1 Lentiviral expression plasmid for RNF5 lentivirus packaging, RNF5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RNF5/RING5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $435.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003006
Gene Name RNF5
Accession Number NM_006913
Gene ID 6048
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 543 bp
Gene Alias RING5,RMA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGCAGCGGAGGAGGAGGACGGGGGCCCCGAAGGGCCAAATCGCGAGCGGGGCGGGGCGGGCGCGACCTTCGAATGTAATATATGTTTGGAGACTGCTCGGGAAGCTGTGGTCAGTGTGTGTGGCCACCTGTACTGTTGGCCATGTCTTCATCAGTGGCTGGAGACACGGCCAGAACGGCAAGAGTGTCCAGTATGTAAAGCTGGGATCAGCAGAGAGAAGGTTGTCCCGCTTTATGGGCGAGGGAGCCAGAAGCCCCAGGATCCCAGATTAAAAACTCCACCCCGCCCCCAGGGCCAGAGACCAGCTCCGGAGAGCAGAGGGGGATTCCAGCCATTTGGTGATACCGGGGGCTTCCACTTCTCATTTGGTGTTGGTGCTTTTCCCTTTGGCTTTTTCACCACCGTCTTCAATGCCCATGAGCCTTTCCGCCGGGGTACAGGTGTGGATCTGGGACAGGGTCACCCAGCCTCCAGCTGGCAGGATTCCCTCTTCCTGTTTCTCGCCATCTTCTTCTTTTTTTGGCTGCTCAGTATTTGA
ORF Protein Sequence MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1466-Ab Anti-RNF5/ RING5/ RMA1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1466-Ag RNF5 VLP (virus-like particle)
    ORF Viral Vector pGMLP003006 Human RNF5 Lentivirus plasmid
    ORF Viral Vector vGMLP003006 Human RNF5 Lentivirus particle


    Target information

    Target ID GM-MP1466
    Target Name RNF5
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6048
    Gene ID 100051626 (Equus caballus), 101096477 (Felis catus), 407784 (Rattus norvegicus), 474858 (Canis lupus familiaris)
    54197 (Mus musculus), 6048 (Homo sapiens), 616187 (Bos taurus), 717234 (Macaca mulatta)
    Gene Symbols & Synonyms RNF5,Rnf5,NG2,2410131O05Rik,RMA1,RING5
    Target Alternative Names 2410131O05Rik,E3 ubiquitin-protein ligase RNF5,NG2,RING finger protein 5,RING5,RMA1,RNF5,Ram1 homolog (HsRma1),Rnf5
    Uniprot Accession O35445,Q5M807,Q99942
    Additional SwissProt Accessions: Q5M807,O35445,Q99942
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Protein processing in endoplasmic reticulum
    Gene Ensembl ENSCAFG00845014858, ENSMUSG00000015478, ENSG00000204308, ENSBTAG00000025413, ENSMMUG00000018438
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.